(data stored in ACNUC7421 zone)

EMBL: CP000438.CHER

CP000438.CHER        Location/Qualifiers
FT   CDS_pept        complement(197548..198390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="PA14_02200"
FT                   /product="putative chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15132"
FT                   /db_xref="GOA:A0A0H2ZKB0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB0"
FT                   /protein_id="ABJ15132.1"
FT                   /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQLV
FT                   YSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCARLGV
FT                   YPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRPVGQTVYSPA"
     atgcccacct ccacgccttc gccggtgttc ggcaaccagg agttccacta cacccgcgag        60
     gacttccagc aagtacgcga gcggctctac cggctgaccg gcatcagcct ggccgagagc       120
     aaggcgcaac tggtctatag ccgcctctcg cggcgcctgc gcctgctgcg gctcggcagc       180
     ttcgccgaat atttcaccca cctcgaccgc gagccgggcg agcagcagtt gttcgtcaac       240
     gcgctgacca ccaacctcac cgcattcttc cgcgaacgcc accacttccc cctgctcgcc       300
     gacctcgccc gccgccagtt gcagcggcat cgcccgctgc gcatctggtc ggcggcggcg       360
     agcaccggcg aggaacccta ttcgatcgcc atcaccctgg tggaggcgct gggcagcttc       420
     gatccgccgg tgaagatcgt cgcctcggac atcgacaccg gggtgctcga ctgcgcccgc       480
     ctgggcgtct atccgctgga gcgcctggag cagatgccgg cgccgctgaa gaaacgcttc       540
     ttcctccgtg gcaccgggcc caacgccggc aaggcgcggg tggtggagga actgcggcaa       600
     ctggtggagt tccgccagat caacctgctg gaagcggact ggtcgatcgc cggagaactc       660
     gacgcgatct tctgccgcaa cgtgatgatc tacttcgaca agccgaccca gacccgcctg       720
     ctggaacgca tggtggccct gctgcggccg gagggcctgt tcttcgccgg gcattcggag       780
     aacttcgtcc acgccagcca cctggtgcgg cccgtcggcc agaccgtcta cagcccggcc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page