(data stored in ACNUC7421 zone)

EMBL: CP000438.CHEW

CP000438.CHEW        Location/Qualifiers
FT   CDS_pept        complement(200535..201020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="PA14_02230"
FT                   /product="putative purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15134"
FT                   /db_xref="GOA:A0A0H2ZKI9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI9"
FT                   /protein_id="ABJ15134.1"
FT                   /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
     atgaacggca ctgaggcaag ccaggcgaac ggcccggcgc aggaatacct gaccttcacc        60
     ctgggccgcg aggagtacgc catcgacatc ctccgcgtgc aggagatccg cggctacgac       120
     caggtcaccg cgatcgccaa cgcgccgccc ttcatcaagg gcgtgatcaa cctgcgcggg       180
     gcgatcgtgc cgatcgtcga cctgcgcatc aagttccacc tcgccgaggt cacctacgac       240
     ccgttcaccg tggtgatcat cctcaacatc ggccggcgca tcgtcggcgt ggtggtggac       300
     tcggtatccg acgtgatcgc cctgggcggc gacgcgatca ggccgccgcc ggagttcggc       360
     gccagcttcg acaccgaata cctgctcggc ctggccaccg cgggcgagcg catgttgatc       420
     ctggtggaca tcgagagact gatgaccagc cgcgaaatgg cgctggtcga cgaagccgcg       480
     gcctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page