(data stored in ACNUC7421 zone)

EMBL: CP000438.CHPC

CP000438.CHPC        Location/Qualifiers
FT   CDS_pept        477315..477821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="PA14_05410"
FT                   /product="putative chemotaxis protein methyltransferase
FT                   CheR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15382"
FT                   /db_xref="GOA:A0A0H2ZLA3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA3"
FT                   /protein_id="ABJ15382.1"
FT                   /translation="MNQAVIEQDGMSRNTPANPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGVPQWYLGQVAWRDLRLPLLSFEAASSGEQQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLASTAAPLAALELAAVDIGGETARIPDLAGLEEKLA
FT                   DAGLI"
     atgaaccagg ccgtgatcga gcaggatggc atgagccgga acaccccagc caacccgacc        60
     ccggacagcc tcaccgggct gctcctgccg ctgagcgacc gcaccctgct gttgcccaac       120
     gtcgccgtgg ccgaactgat cgcctatcgc aacccgcagg tcgccgccgg cgtgccgcag       180
     tggtacctgg gccaggtggc ctggcgcgac ctgcgcctgc cgctgctgtc cttcgaggcg       240
     gcctccagcg gcgaacagca gccggtactc ggcagcagcg cgcgggtggt ggtcatcaac       300
     gccctcggcg gacgacccca tgtgaaattc ctcgccctgc tggtgcaggg cattccgcgc       360
     tcggtgcggc tggacgccaa tctcgcgagc accgccgcgc cgctggcggc gctggaactg       420
     gcggcggtgg acatcggcgg cgaaaccgcg cggattccgg acctggccgg gctcgaagag       480
     aagctcgccg acgccggcct gatctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page