(data stored in ACNUC7421 zone)

EMBL: CP000438.CHPE

CP000438.CHPE        Location/Qualifiers
FT   CDS_pept        478700..479311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="PA14_05430"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15384"
FT                   /db_xref="GOA:A0A0H2ZK58"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK58"
FT                   /protein_id="ABJ15384.1"
FT                   /translation="MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGE
FT                   QGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
     atgctcgcca tcttcctcgc cgccttgctg ttcggtttcg ccttcaatgt ttctcctggc        60
     gcggtgttca gcgaaacgct gcgccgtggt ttgaccggcg gcttccgccc ggcgttgctg       120
     gtgcaactgg ggtcgctgat cggcgatgcc gtctgggccc tgctcgggct caccgggctg       180
     gcgctgctgc tgggctacga acaggtgcgg attcccctga ccctggcctg tgccgcctac       240
     ctggcctggc taggcgtgca aggcttgcgc gacgcctgga gtccgccgct ggcggcggag       300
     gatgccggcg agcaggggcg caacgccttc ggcgccggcg cggcgatctc cctgtccaac       360
     ccgaagaacg tggtctattg gggcgccctc ggcagcgccc tggcggggat cgtcgacggc       420
     acgccgaacc aggcgcagtc gctggtgttc ttcgccggtt tcatgctctc gtcgctgatc       480
     tggtgctttt gctgcgcggc gctggtggac tggctgcggc gcaacacctc gctgttctgg       540
     caccgcgtca gctacgccgg ttgcggcgtg ctcctgctcg gcctggcggg actggcgctg       600
     cgcgggctgt ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page