(data stored in ACNUC7421 zone)

EMBL: CP000438.COIII

CP000438.COIII       Location/Qualifiers
FT   CDS_pept        128595..129482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /gene_synonym="cox3"
FT                   /gene_synonym="coxC"
FT                   /locus_tag="PA14_01320"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15065"
FT                   /db_xref="GOA:A0A0H2ZJT6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT6"
FT                   /protein_id="ABJ15065.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILSIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
     atggcaagcc acgaacacta ttacgtcccc gcccagagca agtggccgat catcgccagc        60
     atcggcctgc tggtgacggt gttcggcctg ggtacctggt tcaacgacct caccgccggc       120
     cacaaggaat cccatggccc gtggatcttc ttcgtcggcg ggctgatcat cgcctacatg       180
     ctgttcggct ggttcggcaa cgtcatccgc gagagccgcg ccggactcta cagtgcgcag       240
     atggaccgct cgttccgctg gggcatgagc tggttcatct tctccgaggt gatgttcttc       300
     gccgccttct tcggcgcgct gttctacgtc cgccacttcg ccggtccctg gctcggcggc       360
     gagggtgcca agggcgtggc gcacatgctc tggccgaact tccagtacag ctggccgctg       420
     ctgcagaccc cggacccgaa gctgttcccg ccgccgagcg cggtgatcga gccgtggaag       480
     ctgccgctga tcaacaccat cctgctggtc acctccagct tcaccgtgac cttcgcccac       540
     cacgccctga agaagaacaa gcgcggcccg ctcaaggcct ggctggcgtt gaccgtgctg       600
     ctggggatcg ccttcctgat cctgcaggcc gaggagtacg tgcacgccta caacgagctg       660
     ggcctgaccc tcggcgccgg tatctacggc tcgaccttct tcatgctcac cggcttccac       720
     ggcgcccacg tgaccctcgg cgcgctgatc ctcagcatca tgctgatccg catcctgcgc       780
     ggtcacttcg atgccgagca ccacttcggc ttcgaggccg ccagttggta ctggcacttc       840
     gtcgatgtgg tctggatcgg cctgttcatc ttcgtctacg tgatctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page