(data stored in ACNUC7421 zone)

EMBL: CP000438.COXA

CP000438.COXA        Location/Qualifiers
FT   CDS_pept        126427..128019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /gene_synonym="ctaD"
FT                   /locus_tag="PA14_01300"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15063"
FT                   /db_xref="GOA:A0A0H2ZK46"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK46"
FT                   /protein_id="ABJ15063.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
     atgagtgctg tgatcgatac gcccgaccac catgccggcg accaccacca cggaccggcc        60
     aagggcctga tgcgctgggt gctgacgacc aaccacaagg acatcggcac cctctacctg       120
     tggttcagct tcatgatgtt cctgctcggc ggctcgatgg ccatggtgat ccgcgccgag       180
     ctgttccagc ccggcctgca gatcgtcgag ccggcgttct tcaaccagat gaccaccatg       240
     cacggcctga tcatggtctt cggcgcggtg atgccggcct tcgtcggcct ggccaactgg       300
     atgatcccgc tgatgatcgg cgcgccggac atggccctgc cgcggatgaa caacttcagc       360
     ttctggctgc tgccggcggc cttcggcctg ctggtcagca ccctgttcat gcccggcggc       420
     ggtcccaact tcggctggac cttctacgcg ccgctgtcga ccaccttcgc cccgcacagc       480
     gtgaccttct tcatcttcgc catccacctg gccgggatca gctcgatcat gggcgcgatc       540
     aacgtgatcg ccaccatcct caacctgcgc gccccgggca tgaccctgat gaagatgccg       600
     ctgttcgtct ggacctggct gatcaccgcg ttcctgttga tcgcggtgat gccggtgctg       660
     gccggcgtgg tgaccatgat gctgatggac atccacttcg gcaccagctt cttcagcgcc       720
     gccggcggcg gcgacccggt gctgttccag cacgtgttct ggttcttcgg ccaccccgag       780
     gtgtacatca tgatcctgcc cgccttcggt gcggtcagtg cgatcatccc gaccttcgcg       840
     cgcaagccgc tgttcggcta cacctcgatg gtctacgcca ccgccagcat cgccttcctc       900
     tccttcgtgg tctgggcgca ccacatgttc gtggtcggca tcccggtcac cggcgagctg       960
     ttcttcatgt acgccaccat gctgatcgcg gtgcccaccg gggtgaaggt gttcaactgg      1020
     gtgaccacca tgtgggaggg ttcgctgacc ttcgagacgc cgatgctgtt cgccgtggcc      1080
     ttcgtcatcc tgttcaccat cggcggcttc tccggactga tgctggcgat cgccccggcg      1140
     gacttccagt accacgacac ctacttcgtg gtcgcccact tccactacgt gctggtgccc      1200
     ggcgcgatct tcggcatctt cgcctcggcc tactactggc tgccgaagtg gaccggccac      1260
     atgtacgacg agaccctcgg caagctgcac ttctggatga gcttcatcgg catgaacctg      1320
     gcgttcttcc cgatgcactt cgtcggcctc gccggcatgc cgcgacggat ccccgactac      1380
     aacctgcagt tcgccgactt caacatggtc tcgtcgatcg gcgccttcat gttcggcacc      1440
     acccagctgc tgttcctgtt catcgtcatc aagtgcatcc gcggcggcaa gccggcccct      1500
     gccaagccct gggacggcgc cgagggcctg gagtggagca tcccttcgcc ggcgccctac      1560
     cacaccttca gcaccccgcc cgaggtcaag tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page