(data stored in ACNUC7421 zone)

EMBL: CP000438.COXB

CP000438.COXB        Location/Qualifiers
FT   CDS_pept        125293..126417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /gene_synonym="coxII"
FT                   /gene_synonym="ctaC"
FT                   /locus_tag="PA14_01290"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15062"
FT                   /db_xref="GOA:A0A0H2ZK39"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK39"
FT                   /protein_id="ABJ15062.1"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
     atgctgcgac atccacgagt ctggatgggc ttccttttgc tctcggcgat cagccaggcg        60
     aatgccgcct ggacggtcaa catggccccg ggcgctaccg aggtgagccg gtccgtcttc       120
     gacctgcaca tgaccatctt ctggatctgc gtggtgatcg gcgtgctggt cttcggcgcg       180
     atgttctggt cgatgatcgt ccaccgccgc tccaccggcc agcagccggc gcatttccac       240
     gagagcacca cggtggaaat cctctggacg gtggtgccgt tcgtgatcct ggtggtgatg       300
     gcggtgcccg ccacccgcac cctgatccac atctacgaca cttccgagcc ggagctggac       360
     gtgcaggtca ccggctacca gtggaagtgg cagtacaagt acctgggcca ggacgtcgag       420
     tacttcagca acctggccac cccgcaggac cagatccaca accggcaggc gaaggacgag       480
     cattacctgc tggaggtgga cgagccgctg gtgctgccgg tgggcaccaa ggtgcgcttc       540
     ctgatcacct ccagcgacgt gatccattcc tggtgggtgc cggccttcgc ggtcaagcgc       600
     gacgccatcc ccggcttcgt caacgaggcc tggaccaagg tcgacgagcc cggcatctac       660
     cgcggccagt gcgccgagct gtgcggcaag gaccacggct tcatgccgat cgtggtcgac       720
     gtcaagccca aggccgagtt cgaccagtgg ctggccaagc gcaaggaaga ggcggcgaaa       780
     gtcaaggaac tgaccagcaa ggagtggacc aaggaagaac tggtcgcgcg cggcgacaag       840
     gtctaccaca ccatctgcgc cgcctgccac caggccgaag gccagggcat gccgccgatg       900
     ttcccggcgc tgaagggctc gaagatcgtc accgggccca aggagcacca cctggaagtg       960
     gtcttcaacg gcgtgcccgg caccgccatg gcggccttcg gcaagcagct caacgaggtc      1020
     gacctggccg cggtgatcac ctacgagcgc aacgcctggg gcaacgacga tggcgacatg      1080
     gtcaccccga aagacgtcgt cgcctacaag cagaaacaac aatag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page