(data stored in ACNUC7421 zone)

EMBL: CP000438.COXG

CP000438.COXG        Location/Qualifiers
FT   CDS_pept        128030..128584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="PA14_01310"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15064"
FT                   /db_xref="GOA:A0A0H2ZKB7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB7"
FT                   /protein_id="ABJ15064.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARKPPVPVAGR"
     atgagcgatg ccaaggtcga tacccgccgc ctggtcggcc gcctgctgct ggtgaccgtg        60
     ctgatgttcg ccttcggctt cgccctggtg ccgctctacg acgtgatgtg ccgcgccctg       120
     gggatcaacg gcaagaccgc cggcagcgcc tacagcggcg aacagcaggt ggatgtcggg       180
     cgcgaggtga aggtgcagtt catgacctcg aacaatatcg acatggtctg ggagttccgc       240
     tccgccggcg accagttggt ggtgcatccc ggcgcggtga accagatggt gttctacgcg       300
     cgcaacccga gcgacaagcc gatgaccgcg caggccatcc cgagcatcgc cccggccgag       360
     gccgccgcct acttccacaa gaccgaatgc ttctgtttca cccagcaggt gctgcaaccc       420
     ggcgagagca tcgagatgcc ggtgcgcttc atcgtcgacc gcgatctgcc caaggatgtg       480
     cggcacgtga cgctggccta caccctcttc gatatcactg cgcggaagcc gcccgtaccg       540
     gttgcgggac gataa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page