(data stored in ACNUC7421 zone)

EMBL: CP000438.CREC

CP000438.CREC        Location/Qualifiers
FT   CDS_pept        536757..538181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /gene_synonym="blrB"
FT                   /locus_tag="PA14_06070"
FT                   /product="two-component sensor CreC"
FT                   /note="catabolite repression sensor kinase for PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15429"
FT                   /db_xref="GOA:A0A0H2ZLE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE9"
FT                   /protein_id="ABJ15429.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSAGVAVGQDYSRWNDVYLTLRGQYGARSSREDPDDPDSSVMYVAAPIKDAGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTQYAQAVSE
FT                   GRRAELPRYRGGEMAQLADAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVGNIAGESERLQQLIERLLSLAQVEQRQGLEEVGKVDLREIAASLLE
FT                   GQAARIQRQRLRVENRLEGPCEVRGEQFLLRQALANLLDNALDFTPPGGILRLLAEADG
FT                   EGIALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNRDDGVEALLWLPRG"
     atgccgctcg gcgttcggat cttcctggtc tacttcctgt tcgtcggtct caccggctac        60
     ttcgtgctga gcacggtgat ggacgaagtg cgccccggcg tgcgccagtc caccgaggaa       120
     accctggtgg acaccgccaa cctgctcgcc gagatcctcc gccaggacgt gaagaacggc       180
     accctggcac agagcgacct gccggagatg ctcgaggact acggcaagcg ggtgccgcag       240
     gcggatatct ggggcttgcg caaggaggcg gtgaaccacc gcatctacgt caccgacgcc       300
     agcggcaagg tgctgctgga ctccgccggg gtggccgtcg gccaggacta ttcgcgctgg       360
     aacgacgtct acctaaccct ccgtggccag tacggcgcgc gctccagccg cgaagacccg       420
     gacgacccgg attcctcggt gatgtacgtg gcggcgccga tcaaggatgc cgggaagatc       480
     atcggggtgg tttcggtggc caagccgaac agcagcctgc aaccttacat cgaccgctcg       540
     cagcggcgcc tggcctggct cggtgccggg ctgatcgccc tcgggctgct ggtcggcggc       600
     ctgctctcct ggtggctcag cggcgcgctg cggcgcctca cccagtacgc ccaggcggtc       660
     agcgaggggc gccgcgccga gctgccgcgc tatcgcggcg gcgagatggc gcaactggcc       720
     gacgcggtgg agcgcatgcg cacgcaattg gagggcaagg actacgtcga gcgctacgtg       780
     cataccctga cccacgaatt gaagagcccg ctggcggcga tccgtggcgc cgccgagttg       840
     ctcgacggcg agatgccggc cgaacagcgg gcgcgcttcg tcggcaacat cgccggcgag       900
     agcgagcgcc tgcaacaact gatcgagcgc ctgctgagcc tggcccaggt ggagcagcgg       960
     caaggcctgg aggaggtcgg caaggtcgac ctgcgggaga tcgccgcgtc cctgctggaa      1020
     ggccaggcgg cgcgtatcca gcgccagcga ttgcgggtgg agaatcgcct ggaaggtccc      1080
     tgcgaggttc gcggcgagca gttcctgctg cgccaggcgc tggccaacct gctcgacaac      1140
     gccctcgact ttaccccgcc cggcggcatc cttcgcctgc tcgccgaggc cgacggcgag      1200
     ggtatcgccc tgcgcctgtt caaccagggg ccggcgattc ccgactacgc cctggcgcgc      1260
     ctcaccgaac gcttctactc gctgccgcgc ccggccagcg ggcgcaagag caccgggctg      1320
     ggactgaact tcgtcgccga ggtggcgcaa ctgcatggcg gccggttgca ggtcggcaat      1380
     cgcgacgacg gcgtcgaggc gctgctctgg ctgccgcgcg gctga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page