(data stored in ACNUC7421 zone)

EMBL: CP000438.CRED

CP000438.CRED        Location/Qualifiers
FT   CDS_pept        538283..539641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /gene_synonym="blrD"
FT                   /locus_tag="PA14_06080"
FT                   /product="inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15430"
FT                   /db_xref="GOA:A0A0H2ZKM3"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM3"
FT                   /protein_id="ABJ15430.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEVRDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTEKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVAGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGASVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLSLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAQGFTARWQTSFFATNMEEALRSCVEEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPIQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLVSAGACVGLIGFYLCFVLRSVARGLGFSAGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDLPAVPDRA"
     atgaaccgca cgctggccta caagctcggc gccatcgccc tactcatcct gctattgctg        60
     attcccctgt tgatgatcga cggcctgatc cgcgatcgcc aggaggttcg tgacggcgtg       120
     ctgcaggata tcgcccgcag ctccagctac agccagcgcc tcaccggccc gctgctggtg       180
     gtgccgtacc gcaggacggt gcgcgagtgg gtcaccgagg agaagaccga gaagcgcgtg       240
     ttgcaggagc gcgagcagcg cggcgagctg tacttcctgc ccgaccgctt cgccctcgac       300
     gggcagatgc gcaccgagct gcgctaccgt ggcatctacc aggcgcgcct gtaccacgtc       360
     gacaacaagg ttgccggcta cttccaggtg cctgcgcact atggcatcga agaagacttg       420
     gaggactacc agttcgaaac gccgttcctg gcgatgggca tcagcgacat ccgcggcatc       480
     gagaatgccc tgcgcctgtc cctcaacggt gccagcgtcg acttcgagcc gggtagccgg       540
     gtcggcctgc tcggcagcgg tgtgcacgca ccgctgcaag gcgtcgacgg gcgccaggcg       600
     cagcgcctgg agtacgcctt cgacctgtcg ttgctcggca gcgagcggct ggacatcgtg       660
     ccggtgggcc gcgacagcca ggtcatcctg aaggccgact ggccgcaccc gagcttcggc       720
     ggcgagttcc tgcccagcga gcgggagatc accgcccagg gcttcaccgc gcgctggcag       780
     accagcttct tcgccaccaa catggaagag gcgctgcgca gttgcgtgga ggagcagcgc       840
     tgcgacggtt tccaggcgcg cgccttcggc gtcggcctgg tcgatccggt ggaccagtac       900
     ctgaaggccg accgcgcgat caagtacgcg ctgctgttca tcaccctgac cttcgccggc       960
     ttcttcctct tcgaggtgct caagcgcctg gcggtacacc cgatccagta cgcgctggtc      1020
     ggcctggcgc tggcgttctt ctacctgctg ctgctgtcgc tggccgagca tgtcggcttc      1080
     gagctggcct acctggtctc cgccggagcc tgcgtcggcc tgatcggctt ctacctgtgc      1140
     ttcgtcctgc gcagcgtggc ccgaggactg ggcttcagcg ccggcctggc agggctgtac      1200
     ggcctgctct acggcttgct gagcgcggag gactacgcct tgctgatggg ctcgctgctg      1260
     ctgttcgcgg tgcttgccgc ggtgatggtg ctgacccgcc gcctggactg gtacggggtc      1320
     ggccgcaagg acctcccggc ggtgcccgac agggcctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page