(data stored in ACNUC7421 zone)

EMBL: CP000438.CSPB

CP000438.CSPB        Location/Qualifiers
FT   CDS_pept        528054..528263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspB"
FT                   /locus_tag="PA14_05960"
FT                   /product="putative major cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15421"
FT                   /db_xref="GOA:A0A0H2ZK92"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK92"
FT                   /protein_id="ABJ15421.1"
FT                   /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAE
FT                   GQKVSFEVVQGQKGMQAERVQVIN"
     atgtcccgtc agaacggcac cgttaagtgg ttcaacgaaa ccaaaggcta cggcttcatt        60
     accccggaaa gcggcccgga cgttttcgtt cacttccgtg ccatcgaagg taacggcttc       120
     aagaccctgg ccgaaggcca gaaggtcagc ttcgaagtcg tacaaggcca gaaaggcatg       180
     caggccgagc gcgttcaggt gatcaactaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page