(data stored in ACNUC7421 zone)

EMBL: CP000438.CTAA

CP000438.CTAA        Location/Qualifiers
FT   CDS_pept        131135..132208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="PA14_01360"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15069"
FT                   /db_xref="GOA:A0A0H2ZKC3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC3"
FT                   /protein_id="ABJ15069.1"
FT                   /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALFLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
     atgtcaggcg caacccgcaa acccggtttc accgtcgccg tgctggcgac cctgctggcc        60
     gccgtggtgg tcctgctcgg cgcctatacc cggctgaccc acgccggcct cggctgtccg       120
     gactggccag gctgctacgg cttcgtccac gtgccgctga gcgaggcgca actggcccac       180
     gccgaactgc acttccccga cgccccggtg gaggcgcaga agggctggaa cgagatgatc       240
     caccgctatt tcgccggcgc cctcggcctg ctcatccttg gcctggcgtt gcatgcgctg       300
     gtccgccgcg ggcgcgacgg ccaaccgctg aagctgccgc tgctgctgct cgcggtggtg       360
     atcgcgcagg ccgccttcgg catgtggacg gtgaccctca agctctggcc gcaggtggtc       420
     accgcccatc tgctcggcgg cttcaccacc ctggcgctgc tctttctcct cgccctgcgc       480
     ctctccggac gcttcgcggc gcggcgctac ccggcggcga cccgcggcct ggcggggctg       540
     gccctgttcc tggtgatcgg ccagatcgcc ctcggcggct gggtcagcag caactatgcg       600
     gcggtggcct gcatcgacct gcccacctgc catggcgagt ggtggccgcg gatggacttc       660
     gccaacggct tccacctgac ccagcacatc ggccccaact acctcggcgg ccagctcgac       720
     agcgacgcgc gcacggcgat ccacatgacc caccggatcg gcgcgctgtg cgtgaccctg       780
     gtcctcctgc tgctcgcctg gcgcctgcag cgcagcggcc tggtctggcc gaccgcgctg       840
     atgctgctcg gcctgtcgct gcagatcggc ctgggcatca gcaacgtgct gctgcacctg       900
     ccgctgccgg tggcggtggc gcacaacggc ggtggcgccc tgctgctgct cagcctggtg       960
     ctggtcaact atcgcctgcg cgcgccggcc agcgtccgcg cgccggcacc gtcgccgcag      1020
     cgcgtgcgcc gcacgctgcc gccggcgcaa ggttcgcggc tgaaggccgc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page