(data stored in ACNUC7421 zone)

EMBL: CP000438.CYSA

CP000438.CYSA        Location/Qualifiers
FT   CDS_pept        complement(328093..329082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PA14_03650"
FT                   /product="sulfate transport protein CysA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15243"
FT                   /db_xref="GOA:A0A0H2ZJS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS9"
FT                   /protein_id="ABJ15243.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDDINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
     atgagcatcg aaatccgtaa cgtcagcaag aacttcaacg ccttcaaggc cctggacgac        60
     atcaacctcg acatccagag cggcgagctg gtggccctgc tcggcccctc cgggtgcggc       120
     aagaccaccc tgctgcggat catcgccggg ctggaaaccc cggacgccgg caacatcgtg       180
     ttccatggcg aggacgtctc gcagcacgac gtgcgcgacc gcaacgtcgg cttcgtcttc       240
     cagcactacg cgctgttccg ccacatgacg gtgttcgaca acgtcgcctt cggcctgcgc       300
     atgaagccca agggcgagcg gccgggcgag tccgcgatca aggccaaggt ccacgagctg       360
     ctcaacatgg tgcagctcga ctggctcgcc gaccgctatc cagagcaact ctccggcggc       420
     cagcggcagc gtatcgccct ggcccgcgcg ctggcggtgg agccgaagat cctgctcctc       480
     gacgaaccct tcggcgccct cgacgccaag gtgcgcaagg agctgcgccg ctggctggcg       540
     cgcctgcacg aggagatcaa cctgacctcg gtgttcgtca cccacgacca ggaagaggcg       600
     atggaagtgg ccgaccgcat cgtggtgatg aacaaaggcg tgatcgagca gatcggctcg       660
     cccggcgagg tctacgagaa cccggccagc gatttcgtct accacttcct cggcgactcc       720
     aaccgcctgc aactgggcaa cgaccagcac ctgctgttcc gcccccacga agtgtcgctg       780
     tcgcgttccg cggtggccga gcaccgcgcc gccgaggtcc gcgacatccg tccgctgggg       840
     gcgatcaccc gggtaacgct gaaggtcgac ggccaggacg aactgatcga agccgaagtg       900
     gtgaaggacc acgacagcct ggccggcctg gcccgcggcg agaccctcta cttcaagccg       960
     aaggccttcc agccggtggc caatctctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page