(data stored in ACNUC7421 zone)

EMBL: CP000438.CYST

CP000438.CYST        Location/Qualifiers
FT   CDS_pept        complement(329966..330784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PA14_03680"
FT                   /product="sulfate transport protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15245"
FT                   /db_xref="GOA:A0A0H2ZKL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL7"
FT                   /protein_id="ABJ15245.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
     atgtcacgac gcatttcccc ggtcataccc ggcttcgggc tgaccctggg atacaccctg        60
     gtgtacctca gcctgctggt cctgatcccg ctgggggcca tgttcctcaa gaccacccag       120
     ctcagctggg agcaattctg ggccatcatc agcgcgccgc gggtgctcgc cgcgctcaag       180
     ctgagcttcg gcaccgcgct cgccgccgcc gtgctcaatg gcttgatcgg tacgctgctg       240
     gcctgggtcc tggtgcgcta cgaattcccc ggacggaaga tcatcgacgc catgatcgac       300
     ctgcccttcg ccctgcccac cgccgtcgcc ggtatcgccc tcaccgcgct ctatgcgccg       360
     gccggcctgg tcggccagtt cgccagcgac ctcggcttca agatcgccta tacccccctg       420
     gggatcaccc tggcgctgac cttcgtgacc ctgccgttcg tggtccgcac ggtgcagccg       480
     gtgctcgccg acattcccaa ggaagtcgag gaagccgccg cctgcctcgg cgccaggccg       540
     ctgcaggtgt tccgccatat cctcgtgccg gcgctgctgc cggcctggct gaccggtttc       600
     gccctggcct tcgcccgggg cgtcggcgaa tacggctcgg tgatcttcat cgccggcaac       660
     atgccgatga agaccgagat cctgccgctg ctgatcatgg tcaagctgga ccagtacgac       720
     tacaccggcg ccaccgccat cggcgtgctg atgctggtgg tgtccttcat cctgctgctg       780
     ctgatcaacc tgctgcagcg tcgcatcgaa accccgtaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page