(data stored in ACNUC7421 zone)

EMBL: CP000438.CYSW

CP000438.CYSW        Location/Qualifiers
FT   CDS_pept        complement(329086..329955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PA14_03670"
FT                   /product="sulfate transport protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15244"
FT                   /db_xref="GOA:A0A0H2ZKS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS1"
FT                   /protein_id="ABJ15244.1"
FT                   /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVL
FT                   SEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSI
FT                   LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPF
FT                   VARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFG
FT                   AVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSR
FT                   LKSNADEE"
     atgtccagtg caagcatttc cgctgccacc gccagcgcct cccgccgcgg caacgccggc        60
     ggccgcctgg ccctgatcgt cctggcctgg ctggtcttcg ccctgttcct cctgctgccg       120
     ctctacgtgg tcctgagcga ggcgctgaag cagggtttcg gcaccttctt cgaggcgatc       180
     ctcgagcccg acgcgctggc cgcgctgaag ctgaccctga tcgcggtggc catctcggtg       240
     ccgctcaatc tgctgttcgg cgtcgccgcc gcctggtgcg tgagcaagtt cgagtttcgc       300
     ggcaagagca tcctggtgac cctgatcgac ctgccgttct cggtctcgcc ggtgatcgcc       360
     ggcctgatct acgtgctgtt gttcggcgcc cagggctact tcggcgaatg gctgagcgac       420
     cacgacatcc agatcgtctt cgcggtgccc ggcatcgtcc tggcgaccct cttcgtcacc       480
     gtgcccttcg tcgcccgcga gctgatcccg ctgatgcagg aacagggcac ccaggaagag       540
     gaggccgccc gcctgctcgg cgccaacggc tggcagatgt tctggcacgt gaccctgccg       600
     aacattaagt ggggcctgat ctacggcgtg gtgctctgca ccgcccgggc gatgggcgag       660
     ttcggcgcgg tgtcggtggt ttccggacac atccgcggcg tcaccaacac cctgccgctg       720
     cacgtcgaga tcctctacaa cgaatacaac catgtcgccg ccttcagcgt cgccagcctg       780
     ttgctgctga tggcgctggt catccttctg ctcaagcagt ggagcgaatc ccgcatgtcc       840
     cgactgaaaa gcaatgctga cgaggaatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page