(data stored in ACNUC7421 zone)

EMBL: CP000438.DEF

CP000438.DEF         Location/Qualifiers
FT   CDS_pept        complement(21088..21594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PA14_00200"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14975"
FT                   /db_xref="GOA:A0A0H2ZK18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK18"
FT                   /protein_id="ABJ14975.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
     atggccatcc tgaacattct cgaattcccc gatccgcgcc tgcggaccat cgccaaaccg        60
     gtggaggtgg tcgacgacgc ggtgcgccag ctgatcgacg acatgttcga aaccatgtac       120
     gaagccccgg gcatcggcct cgccgcgacc caggtgaacg tgcacaagcg catcgtggtc       180
     atggacctca gcgaagacaa gtccgagccg agggtattca tcaaccccga gttcgaaccg       240
     ctgaccgagg aaatggacca gtaccaggaa ggctgcctgt cggtacccgg cttctacgag       300
     aacgtggacc gaccgcagaa ggtccggatc aaggccctcg accgcgacgg caaccccttc       360
     gaggaggtcg ccgaaggcct gctggcggta tgcatccagc acgaatgcga ccacctcaac       420
     ggcaagctgt tcgtcgacta cctgtccacc ctcaagcgcg accgcatccg caagaagctg       480
     gaaaagcagc atcgacagca ggcgtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page