(data stored in ACNUC7421 zone)

EMBL: CP000438.DNAA

CP000438.DNAA        Location/Qualifiers
FT   CDS_pept        483..2027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PA14_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14957"
FT                   /db_xref="GOA:Q02V80"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V80"
FT                   /protein_id="ABJ14957.1"
FT                   /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQTHVAPPPPVA
FT                   PPPAPVQPVSAAPVVVPREELPPVTTAPSVSSDPYEPEEPSIDPLAAAMPAGAAPAVRT
FT                   ERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGR
FT                   PITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
     gtgtccgtgg aactttggca gcagtgcgtg gatcttctcc gcgatgagct gccgtcccaa        60
     caattcaaca cctggatccg tcccttgcag gtcgaagccg aaggcgacga attgcgtgtg       120
     tatgcaccca accgtttcgt cctcgattgg gtgaacgaga aatacctcgg tcggcttctg       180
     gaactgctcg gtgaacgcgg cgagggtcag ttgcccgcgc tttccttatt aataggcagc       240
     aagcgtagcc gtacgccgcg cgccgccatc gtcccatcgc agacccacgt ggctcccccg       300
     cctccggttg ctccgccgcc ggcgccagtg cagccggtat cggccgcgcc cgtggtggtg       360
     ccacgtgaag agctgccgcc agtgacgacg gctcccagcg tgtcgagcga cccctacgag       420
     ccggaagaac ccagcatcga tccgctggcc gccgccatgc cggccggagc cgcgcctgcg       480
     gtacgcaccg agcgcaacgt ccaggtcgaa ggcgcgctga agcacaccag ctatctcaac       540
     cgtaccttca ccttcgagaa cttcgtcgag ggcaagtcca accagttggc ccgtgccgcc       600
     gcctggcagg tggcggacaa cctcaagcac ggctacaacc cgctgttcct ctacggtggc       660
     gtcggcctgg gcaagaccca cctgatgcat gcggtgggca accacctgct gaagaagaac       720
     ccgaacgcca aggtggtcta cctgcattcg gaacgtttcg tcgcggacat ggtgaaggcc       780
     ttgcagctca acgccatcaa cgaattcaag cgcttctacc gctcggtgga cgcactgttg       840
     atcgacgaca tccagttctt cgcccgtaag gagcgctccc aggaggagtt cttccacacc       900
     ttcaatgccc ttctcgaagg cggccagcag gtgatcctca ccagcgaccg ctatccgaag       960
     gaaatcgaag gcctggaaga gcggctgaaa tcccgcttcg gctggggcct gacggtggcc      1020
     gtcgagccgc cggaactgga aacccgggtg gcgatcctga tgaagaaggc cgagcaggcg      1080
     aagatcgagc tgccgcacga tgcggccttc ttcatcgccc agcgcatccg ttccaacgtg      1140
     cgtgaactgg aaggtgcgct gaagcgggtg atcgcccatt cgcacttcat gggtcggccg      1200
     atcaccatcg agctgattcg cgagtcgctg aaggacctgt tggcccttca ggacaagctg      1260
     gtcagcatcg acaacatcca gcgcaccgtc gccgagtact acaagatcaa gatatccgat      1320
     ctgttgtcca agcggcgttc gcgttcggtg gcgcgcccgc gccaggtggc catggcgctc      1380
     tccaaggagc tgaccaacca cagcctgccg gagatcggcg tggccttcgg cggtcgggat      1440
     cacaccacgg tgttgcacgc ctgtcgtaag atcgctcaac ttagggaatc cgacgcggat      1500
     atccgcgagg actacaagaa cctgctgcgt accctgacaa cctga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page