(data stored in ACNUC7421 zone)

EMBL: CP000438.DSBB

CP000438.DSBB        Location/Qualifiers
FT   CDS_pept        complement(606944..607453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PA14_07000"
FT                   /product="disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15501"
FT                   /db_xref="GOA:Q02TM7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TM7"
FT                   /protein_id="ABJ15501.1"
FT                   /translation="MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIF
FT                   IRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGS
FT                   CKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLA
FT                   FGRRTA"
     ttgagcgctc tcctcaagcc cctcgacaac cgcttgttct ggcccgcggt cgccatcggc        60
     ggcctgctga tcctcgcttt cgtactctac ctccagcacg tgcgcggctt cgcgccctgc       120
     tcgctgtgca tcttcattcg cctggacgtg ctcggcctgg tgctcgccgg gatcgtcggc       180
     agcctcgccc cgcgttcgcg gatcgccggc ggcatcgccg cgctgggcat gctcgccgcc       240
     agcctgggcg ggatctacca cgcctggtcg ctggtcgcgg aagagaaact ggctgcccag       300
     ggcatgggca gttgcaagat gttcatgggc ttccccgaat ggataccgct ggacacctgg       360
     ctgccgcagg tcttccagcc cgaggggctg tgcggcgaag tggtctggac cctgctcggc       420
     cagtccatgg cggtctggtc gctggcgctg ttcgtgttct gcctgctggt cctggcggcc       480
     aagctggcgt tcggccgccg caccgcctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page