(data stored in ACNUC7421 zone)

EMBL: CP000438.EXBB1

CP000438.EXBB1       Location/Qualifiers
FT   CDS_pept        224960..225679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /gene_synonym="exbB"
FT                   /locus_tag="PA14_02500"
FT                   /product="transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15153"
FT                   /db_xref="GOA:A0A0H2ZKC1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC1"
FT                   /protein_id="ABJ15153.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
     atgagtctgt taaccacccc gctcgaatcc gtcgaaggcg ccgtcatctg gctgctggtc        60
     ggcttttccg tggtcacctg gggcctggcc ctggtcaagg gcgtgcagtt cgcccggcag       120
     aagcgccagg accgccagtt ccagaagcag ttctggagcg ccaccagcct cgactccgct       180
     ggcgagcagg cgcaggacaa gcagggcgcc ggcgcccgcg tggcccaggc cggcttcgcc       240
     gcgatccagg tgcaggacaa cggccagccc gacctggccc agtcgatcaa ccaccaggac       300
     cgtctcgaac gcgccctgcg ccagcagatc cagcgcgagc ggcgttctct ggagtcgggc       360
     ctggcggtgc tcgcctcgat cggctcgacc tcgcccttca tcggtctgtt cggcaccgtc       420
     tggggcatca tggaggcgct caaggggatc agcgcggccg gctcggcgag cctggagacc       480
     gtggccgggc cgatcggcag cgcgctgatc gccaccggcg tgggaatcgc cgtcgcggtg       540
     ccggcggtgc tggtctacaa ctacttcctg cggcgcctga agctgaccgc cgccgacctc       600
     gacgacttcg cccacgactt ctacagcctg gcgcagaaga gcgcgttccg cgtcatcgtc       660
     catccctccg ccgcgcgcca ggccggcaac ccctcgcgca acgtgaagga ggcgtcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page