(data stored in ACNUC7421 zone)

EMBL: CP000438.FIUA

CP000438.FIUA        Location/Qualifiers
FT   CDS_pept        complement(542843..545236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuA"
FT                   /locus_tag="PA14_06160"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15435"
FT                   /db_xref="GOA:A0A0H2ZKM8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM8"
FT                   /protein_id="ABJ15435.1"
FT                   /translation="MPRPTFRPGLLALAIALAVPAPFLHAAPAEQASVRDYRIAAGPLA
FT                   GTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALKGSGLELVENAGGTYS
FT                   LRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATRQQ
FT                   MTDRAVHNLDDAVRYMPGVVASSFGSDTRSDWLKVRGFKPTQFLDGLPMAVGVYNNPKL
FT                   ETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVTSHEVKAEVGNYNHKQVSFDS
FT                   TGPLDDEGRFLYRISGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLGQFNRDD
FT                   TGITSQFLPLRGTKYDAPFGKVSHHKNLGDPDWEYYDRTYYWLGYAFERRINDVWQFRQ
FT                   NLRYLRNDLSFQAVTAGTAHADGTLERSTTSVDEDVSQFVVDNNFQADFETGALRHTLL
FT                   LGLDHNRTDNQYTSIFGSAPPSNVNNPIYGQPIVKPDRSTAFYDYKQKTYQTGLYVQDQ
FT                   IALDNWRLTLGGREDWVHTGATFYNKGDATNTSRDKKFSGNAALSYIFDNGVAPYISYA
FT                   ESFQPTTGADMNSTSSLKPTEGKQWEIGVKYQPVGSDSLFTAAVYDLRQENVSVSQNIG
FT                   GTPVTSQTGEVKVSGIELEATSNVTDNLKLIGAYSYADTEVKKGQYAGNRLQQAPRNQA
FT                   SLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAVRYDLGQLNG
FT                   SLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
     atgccccgcc cgacgttccg tcccggcctg ctcgccctcg ccatcgccct cgccgttccc        60
     gcaccgttcc tccacgccgc cccggccgaa caggccagcg tgcgcgacta ccgcatcgcc       120
     gccgggccgc tggcaggcac cctgaaccgc atcgcggccc aggccggcct ggtcctcacc       180
     ctggacccgg cgctcgccga aggacgcagc gcccacgccg tacaaggtcg cttcgacgcg       240
     cccggcgcat tgcgcgaagc gctcaagggc agcggcctgg agctggtgga aaatgccggc       300
     ggcacctaca gcctgcgcaa ggtgccggaa gacaccctgt cgttgcaggc gatgacggtc       360
     agcggcgccg aggaagaccc actggggccg accagcggct acgtggccaa gcgcagcatg       420
     accgggacca agaccgatac gccgatcctc gagaccccgc gctcgatctc ggtggcgacc       480
     cgccagcaga tgaccgaccg cgccgtgcac aacctcgacg acgcggtgcg ctacatgccc       540
     ggcgtcgtcg ccagcagctt cggcagcgac acccgctccg actggttgaa ggtgcgcggc       600
     ttcaagccga cccagttcct cgacggcctg ccgatggcgg tcggcgtcta caacaacccg       660
     aagctggaaa cctggaacct ggagcgtgtc gccctgttgc gcggcccggc ctcctcggtc       720
     tacggccaga ccccgcccgg cggcatgctc gacatggtca gcctgcgtcc gcagaacgtc       780
     accagtcacg aggtgaaggc cgaggtcggc aactacaacc acaagcaggt cagcttcgac       840
     agcaccggcc cgctcgacga cgagggacgc tttctctatc gcatctccgg cgtggtgcgc       900
     gacagcaaca cccaggtcga ccatatcgac gacaagcgct acaacatcgc cccgagcctg       960
     acctggaaca tcgacgacga caccaggctg accttcctcg gccagttcaa ccgcgacgat      1020
     accggcatca ccagccagtt cctgccgctg cgcggaacca agtacgacgc gccgttcggc      1080
     aaggtttccc accacaagaa cctcggcgac ccggactggg aatactacga ccgcacctac      1140
     tactggctgg gctacgcctt cgagcggcgg atcaacgatg tctggcagtt ccgccagaac      1200
     ctgcgttacc tgcgcaacga cctgtcgttc caggcggtta cagcgggcac agctcatgcc      1260
     gacggcacac tggaacgcag caccacctcg gtggatgaag acgtcagtca gttcgtagta      1320
     gataacaact tccaggccga cttcgaaaca ggcgccctgc gccacaccct gctgctaggc      1380
     ctggatcaca accgcaccga caatcaatac acatcaatct ttggcagcgc gccgccgagc      1440
     aacgtcaaca acccgatcta cggccagccg atcgtcaaac cggatcgttc gacggccttc      1500
     tacgactaca agcagaagac ctaccagacc ggcctctacg tccaggacca gatcgccctc      1560
     gacaactggc gcctgaccct cggcggtcgc gaggactggg tgcacaccgg ggccaccttc      1620
     tacaacaagg gcgacgccac caataccagc cgcgacaaga agttcagcgg caacgcggcg      1680
     ctcagctaca tcttcgacaa tggcgtggcg ccctacatct cctatgcgga gtcgttccag      1740
     cccaccactg gcgccgatat gaacagcacc agttcgctga agccgaccga aggcaagcaa      1800
     tgggaaatcg gtgtgaagta ccagccggtg ggctccgact cgctgttcac cgccgcggtc      1860
     tatgacctgc gccaggagaa cgtcagcgtg tcgcagaaca taggcggcac gccggtcact      1920
     tcgcagacgg gcgaagtgaa ggtctccggg atagagctgg aagccaccag caacgtcacc      1980
     gacaacctga agttgatcgg cgcctatagc tacgccgaca ccgaagtgaa aaaaggccag      2040
     tacgcaggca accgcctgca acaggcgccg cgcaaccagg cctcgctatg ggccgactac      2100
     acctggcacg agggtgcgct gaacggtttc agcgtgggtg ccggcgcccg ctacgtaggc      2160
     tcgacctacg gcgaccaggc caacacctac gacggctacg ccggctcgta caccctgtac      2220
     gacgccgccg tgcgctacga cctgggccaa ttgaacggca gcctgaaagg cgtcagcgtg      2280
     gcggtcaatg ccaacaatct gttcaacaag gactacctgg cgtcctgcga cggctactac      2340
     tgctactacg gcgaccagcg cagcgtggtg ggcagcgtca gctacaagtg gtga            2394
//

If you have problems or comments...

PBIL Back to PBIL home page