(data stored in ACNUC7421 zone)

EMBL: CP000438.FLIY

CP000438.FLIY        Location/Qualifiers
FT   CDS_pept        complement(367838..368608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="PA14_04090"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15277"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP3"
FT                   /protein_id="ABJ15277.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELEVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSEPYTISSAQLIVRADDTRQFRSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
     atgcgatttc tgccccgcct gctgatgctg gtatccctgg ccgccccgct ggcccatgcc        60
     gagctgctcg acgacgtcca ccagcgcggc gccctgcgca tcgccctgga gggcacctat       120
     ccgccgttca acttcaagca gggcggcaag ctcaccggct tcgagaccga actgggcgaa       180
     ctgctggccg ccgagctgga ggtcaagccg gaattcgtca ccaccgaatg gagcggcatc       240
     ctcgccggcc tgcagagcgg caagtacgac atcgcgctga accaggtctc ggtgaacgag       300
     cagcggcgca aggtcttcga cttcagcgag ccgtacacca tctccagcgc ccagttgatc       360
     gtgcgcgccg acgacacccg ccagttcagg tcgctggaag acctcaaggg cctcaagctc       420
     ggcgtcggcc agggcaccaa ctacgccgac ctggcgaagt cggtggccgg cgtcaacgtg       480
     cgcacctatc cgggcgcccc ggaatacctg caggacctgg ccagcaaacg catcgacgcg       540
     gcgctcaacg accgcctgct gatccccttc gccatccgcg aggccaagct cccggtcaag       600
     cccggcgcgg cggtgggacc ggtggcgaac atggcgattc cctaccggaa gaacaacccg       660
     aagttcggcg aggcgctgaa cgcggcgctg gagaagatca aggccgacgg ccgcttcgcc       720
     aagctctcgg aaaagtggtt cggcctggac gtcagccagc cgccgaagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page