(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSE

CP000438.FTSE        Location/Qualifiers
FT   CDS_pept        433627..434298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PA14_04910"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15340"
FT                   /db_xref="GOA:A0A0H2ZL67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL67"
FT                   /protein_id="ABJ15340.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVADNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
     atgatccgct tcgagcaggt cggcaaacgc tatcccaacg gccacgtagg cctgcacgag        60
     gtgtccttcc gcgtgcaccg tggcgagatc ctcttcgtca ccggccactc cggcgccggc       120
     aagagcaccc tgctgcgcct catcctggcg atggagcgac cgaccagcgg caagctgttg       180
     ctcggcggcc aggacctggg gcgcatcact accgcgcaga tccctttcct gcgccggcag       240
     atcggcgtgg tgttccagaa ccaccaactg ctcaccgatc gtacggtggc ggacaacatc       300
     gccctgccgc tgcagatcct cggcatgccc aagccggaga tcgccaagcg cgtggcctcg       360
     gccctggagc gggtgaacct gaaggaaaag ggcgaggcgt tgccttccga cctttccacc       420
     ggccagcagc agcgggtcgg cattgcccgc gccatcgtcc accagccggc cctgctgctg       480
     gcggacgaac ccaccggcaa cctcgacccg cgactcgcgt cggaaatcat gggcgtgttc       540
     gaggatatca atcgcctggg caccaccgta ctgatcgcca gccacgacct ggccctgatc       600
     gcccgtatgc gccatcgcat gctgaccctg cagcgtggcc ggatcatcgc tgaccgtgag       660
     gacgaggcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page