(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSX

CP000438.FTSX        Location/Qualifiers
FT   CDS_pept        434298..435305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PA14_04920"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15341"
FT                   /db_xref="GOA:A0A0H2ZKG8"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG8"
FT                   /protein_id="ABJ15341.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFSAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SENQGQDLREQIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
     atgagcgcca acgatcttcc ccgtggcccc gaagagggcg caccggaacg caagacccgc        60
     gagaaaccga gccaggaaca gaccgactgg agcggctcgt tcagcgccta cctggaaagc       120
     catcgcgcca gcctggtgga cagcctgcgc cggttgttcg gccacccgtt cggcagcttc       180
     ttcacctgcc tggtgatggg tatcaccctg agcctgccga tgggcctttc gctgctgctg       240
     aacaatgtcg aacggctcgg cggctcctgg cagcgcgccg cgcagatctc cctgttcctc       300
     gacctgaaga ccagcgaaaa ccagggccag gacctgcgcg agcagatcga gcgcctgccg       360
     gacgtgatcg aggcccaact gatcagccgc gagcaggcgc tcagcgaatt gcaggaacag       420
     tccggcctgg gcgaagcgct caaggagctg ccggagaacc cactgccgcc ggtgatctcg       480
     gtcacgccca agcagatcga tcgggccggc ctggaggcac tgcgccagca gctcgcggag       540
     ctgcctcatg tgcagcaggc gcagctcgac ctggtatggg tcgagcgcct gagcgcgatc       600
     ctaaagctcg gcgaacgctt cgtcttcggc ctgactatcc tgctggtgct gactctcttg       660
     ctggtggtgg gcaacaccat ccgcctgcac atcgaaaatc gccgtaacga aatcgaggtg       720
     atcaagctgg tcggcgggac ggacggttac gtgcgccggc cattcctgta catgggcgcg       780
     ttgtacggcc tgggcgcggg catcctgtcc tgggcgctgc tggcctattc gctgaactgg       840
     ctgaacggtt cggtggtcaa cctttcaggg ctgtacggca gcgacttcgg cctgcagggc       900
     gtgccgctgg acgacggcct gtcgctcacc gtcggcgcgg tgctgcttgg ctgggtcggc       960
     gcctggctgg ccgtggcccg ccacctgcgc gagctggcgc cgcgctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page