(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSY

CP000438.FTSY        Location/Qualifiers
FT   CDS_pept        432275..433630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PA14_04900"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15339"
FT                   /db_xref="GOA:A0A0H2ZKT5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT5"
FT                   /protein_id="ABJ15339.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETA
FT                   AAEQRAPADDVAQSLTEQPGRQQPSAAEPAEPPAPVAEAPLAGDEPASAEEHSPRPEAP
FT                   VAQPEPILAAEPEPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSASIGEG
FT                   MASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKAL
FT                   QEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAG
FT                   DTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLH
FT                   TKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTK
FT                   LDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
     atgtttggtt ccaacgacga caagaaggcc ccgcagggcg gggaaaagaa aggtctgttc        60
     ggctggtggc ggaaaaagcc gcaagccggc gagcagcctg ccgatcagcc tgtcgagccg       120
     gtctccgaga cagcggccgc cgagcagcgc gcgcctgccg atgacgtggc gcaatccctg       180
     acagaacagc caggtcggca gcagccctcc gctgccgagc cggccgagcc gccggcgccg       240
     gttgccgaag cgccgctcgc cggtgacgag ccagcgtcgg ccgaggagca ttcgccccgc       300
     cccgaggcgc ccgtcgcaca acccgagcct atcctcgctg ccgagcccga gcccgagccc       360
     gagcccgagc ccgagcccgt tgcgccgctg gccgccgctc cggcagtcag cgagccggcg       420
     accaggccgg gcttcttcgc ccgcctccgg cagggactgt ccaagaccag cgccagcatc       480
     ggcgaaggca tggccagcct gttcctcggc cgcaaggaaa tcgacgacga cctgctcgac       540
     gacatcgaga cgcgcctgct gaccgccgac gtcggcgtcg aggccaccac cctgatcgtg       600
     cagaacctga ccaagcgcgt ggcgcgcaag gagctggccg acagcggcgc gctgtacaag       660
     gcgctgcagg aagagctggc cagcctgctg cgcccggtgg agcagccgtt gcaggtcgac       720
     gtcgcgcgcg agccctatgt gatcctggtg gtcggggtga acggcgtggg caagaccacc       780
     accatcggca agctggcgaa gaagctgcaa ctcgagggca agaaggtcat gctggccgcc       840
     ggcgacacct tccgcgccgc cgccgtggag cagttgcagg tctggggcga gcgcaaccgc       900
     atcccggtga tcgcccagca caccggcgcc gactccgcct cggtgatctt cgacgcggtg       960
     caggccgcca aggcccgcgg catcgacgtg ctgatcgccg ataccgccgg acgcctgcat      1020
     accaaggaca acctgatgga ggagctgaag aaggtgcgcc gggtgatcgg caagctggac      1080
     gagacggcgc cccatgaggt cctgctggtg ctcgacgccg gcaccgggca gaacgccatc      1140
     aaccaggcca agcagttcaa cctcgcggtg gagctgaccg gcctggccct gaccaaactg      1200
     gacggcaccg ccaagggcgg ggtgatcttc gccctggcca agcagttcgg cctgccgatc      1260
     cgctatatcg gtgtcggcga ggggatcgac gatctccgta ccttcgaggc cgacgccttc      1320
     gtccaggcac tcttcgcaga gcgggagaac gcatga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page