(data stored in ACNUC7421 zone)

EMBL: CP000438.GPI

CP000438.GPI         Location/Qualifiers
FT   CDS_pept        690976..691509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpI"
FT                   /locus_tag="PA14_08040"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15583"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN8"
FT                   /protein_id="ABJ15583.1"
FT                   /translation="MSSRLLPPNRSSLERSLGDVLPAELPVPLRELNDPARCEAALLPY
FT                   LAWTRSVDRWDPDWSDEAKRNAVATSFVLHQRKGTLTALRQVVEPIGALSEVTEWWQRS
FT                   PTGVPGTFEITVDVSDRGIDEGTVLELERLLDDVRPVSRHLTRLDLRITPVIRSRHGLA
FT                   VTDGDTLEIFPWKQ"
     atgagtagcc gactgctgcc gccaaacagg agttctctgg aacgctctct gggtgatgta        60
     ttgcctgccg aactgccggt gccgcttcgt gagcttaacg atccggcacg ctgtgaggcg       120
     gccttgctgc cctacctggc ctggacgcgc tcggtggacc gctgggaccc ggactggagc       180
     gacgaggcca agcgcaatgc ggtagcgacg tccttcgtcc tgcaccagcg caaaggcacg       240
     ctgacagcgt tgcgccaagt ggtcgagccg atcggtgcgc tgagcgaggt caccgaatgg       300
     tggcagcgaa gcccgaccgg cgtgccgggg accttcgaga tcaccgtgga cgtcagcgac       360
     cgtggcatcg acgaaggcac cgtactggag ctggagcgct tgctcgatga cgtccgcccg       420
     gtgagccgac acctgacccg cctggacctg cgcatcaccc cggtaatccg gtcccgtcac       480
     ggactggccg tgaccgacgg cgacaccctg gaaatcttcc cctggaaaca gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page