(data stored in ACNUC7421 zone)

EMBL: CP000438.GPV

CP000438.GPV         Location/Qualifiers
FT   CDS_pept        689063..689620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpV"
FT                   /locus_tag="PA14_08010"
FT                   /product="putative baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15580"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLV0"
FT                   /protein_id="ABJ15580.1"
FT                   /translation="MSYVSAEHDRMLAAMILPCVVVAVDLAAARVRVRSGDWTSGWLRW
FT                   HSLAAGKVRHWRAPSIGEQGVLLSPSGGVSMGTFIPGLYGDAGTAPDNSASSETWRFDD
FT                   GASLSYDWAAHRYRVELPSGTVEVRVGASEVRVSDGAVSLKAPKISLEGPVEIAGTLTV
FT                   SGDILGGGSIIDTAGNSNHHTH"
     atgagctatg tcagtgcgga gcatgaccgc atgctcgccg cgatgatcct gccctgcgtg        60
     gtggtcgccg tggacctggc agcggcgcgg gtacgggtgc gctccggcga ctggaccagc       120
     ggctggctgc gctggcactc cctggcagcc ggcaaggttc gccactggcg tgcgccgagc       180
     ataggcgaac agggggtact gctcagtccg tcgggcggag tgtcaatggg tacctttatt       240
     cccggtttgt acggcgatgc gggcacggcg ccggacaaca gcgccagcag tgagacctgg       300
     cgtttcgacg acggcgcctc gttgagttac gactgggctg cgcatcgcta ccgcgtcgag       360
     ctgcccagcg gcaccgtgga agtgagggtc ggcgccagcg aggtgcgggt cagcgacggg       420
     gcggtcagtc tcaaggcgcc gaagatcagc ctggaaggac cggtggagat cgccgggaca       480
     ctgacggtca gcggagacat cctcggcggc ggctcgatca tcgacaccgc cggcaacagc       540
     aaccaccaca cccattga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page