(data stored in ACNUC7421 zone)

EMBL: CP000438.GPW

CP000438.GPW         Location/Qualifiers
FT   CDS_pept        689773..690099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpW"
FT                   /locus_tag="PA14_08020"
FT                   /product="putative baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15581"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ9"
FT                   /protein_id="ABJ15581.1"
FT                   /translation="MIGMDRRSGLPLSGLAHLKQSVEDILTTPLGSRRMRPEYGSKLRR
FT                   MVDMPVSEGWKSAVQAEVARSLGRWEPRIALSAVRVVAVVDGRVDLLLSGVFEGENINM
FT                   EVSA"
     atgatcggga tggatcgccg tagcgggctg cccctgtccg gcctggctca tcttaaacag        60
     tccgtcgagg acatcctgac caccccgttg ggcagcaggc gcatgcgccc cgagtacggc       120
     agcaagctgc ggcggatggt cgacatgccg gtgagcgaag gctggaaaag cgccgtgcag       180
     gccgaggtag cccgttccct ggggcgctgg gaaccgcgca tcgcattgtc tgccgtgcga       240
     gtcgtcgcgg tcgtcgatgg ccgcgtggat ctgctcctga gcggcgtgtt cgagggcgag       300
     aacatcaata tggaggtctc ggcgtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page