(data stored in ACNUC7421 zone)

EMBL: CP000438.GYRB

CP000438.GYRB        Location/Qualifiers
FT   CDS_pept        4275..6695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PA14_00050"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14960"
FT                   /db_xref="GOA:A0A0H2ZJS1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS1"
FT                   /protein_id="ABJ14960.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESAMQGWLEKF
FT                   QARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
     atgagcgaga acaacacgta cgactcttcc agcatcaagg tgctgaaggg gctggatgcc        60
     gtacgcaagc gccccggcat gtacatcggc gacaccgacg atggcaccgg tctgcaccac       120
     atggtgttcg aggtggtgga taactccatc gacgaagcgc tggccggtta ctgcagcgaa       180
     atcagcatca ccatccatac ggatgagtcg atcactgtcc gcgacaatgg acgcggtatt       240
     ccggtggata tccacaagga agaaggggtt tctgcggcgg aagtgatcat gaccgtcctc       300
     cacgccggcg gcaagttcga cgacaacacc tacaaagtgt ccggcggctt gcacggtgtg       360
     ggcgtctcgg tggtgaacgc gctgtcccat gagctgcgcc tgaccatccg tcgccacaac       420
     aaggtctggg aacaggtcta ccaccacggc gttccgcagt tcccactgcg cgaagtgggc       480
     gagaccgatg gctccggtac cgaagttcac ttcaagccgt ccccggagac cttcagcaac       540
     atccacttca gttgggacat cctggccaag cgcatccgcg aactgtcctt cctcaactcc       600
     ggcgtcggca tcctgctgcg cgacgagcgt accggcaagg aggagctgtt caagtacgaa       660
     ggcggtctga aggccttcgt cgagtacttg aacaccaaca agaccgcggt gaacgaggta       720
     ttccacttca acgtccagcg tgaagaggac ggcgtgggtg tggaagtcgc cttgcagtgg       780
     aacgacagct tcaacgagaa cctgctctgc ttcaccaaca acatcccgca gcgtgatggc       840
     ggcacccacc tggccggttt ccgttcggcg ctgacgcgta acctgaacaa ctacatcgag       900
     gccgaaggcc tggcgaagaa attcaagatc gccaccaccg gcgacgatgc ccgcgaaggc       960
     ctcaccgcga tcatctcggt gaaggtaccg gacccgaagt tcagctcgca gaccaaggac      1020
     aagctggtct cctccgaggt gaagaccgcg gtggaacagg agatgggcaa gtacttcgcc      1080
     gacttcctgc tggagaatcc caacgaagcc aaggccgtgg tcggcaagat gatcgacgcc      1140
     gcccgtgccc gtgaagccgc gcgcaaggcg cgcgagatga cccgccgcaa gggcgcgctg      1200
     gacatcgccg gcctgcccgg caaactggcc gattgccagg aaaaggaccc ggcgctctcc      1260
     gaactgtaca tcgtggaggg tgactccgcg ggcggttccg ccaagcaggg ccgcaatcgc      1320
     cggacccagg cgatcctgcc gctcaagggc aagatcctca acgtcgagaa ggcacgcttc      1380
     gacaagatgc tctcctccca ggaggtcggt acgctgatca ccgccctggg ctgtggcatc      1440
     ggccgcgagg agtacaacat cgacaagctg cgctaccaca acatcatcat catgaccgat      1500
     gctgacgtcg acggttcgca catccgcacc ctgctgttga ccttcttctt ccgccagatg      1560
     cccgagctga tcgagcgtgg ctacatctac atcgcccagc ccccgttgta caaggtcaag      1620
     cgtggcaagc aggagcagta catcaaggac gaccaggcca tggaagagta catgacccag      1680
     tcggccctgg aagacgccag cctgcacgtc aacgagcacg ctccgggcct gtccggggca      1740
     gcgctggaga aactggtcaa cgagtatcgc ggggtgatcg ccaccctcaa gcgcctgtcg      1800
     cgcctgtacc cccaggagct gaccgagcac ttcatctacc tgcctaccgt gtcggtggac      1860
     gacctggcta acgagtcggc catgcagggc tggttggaga agttccaggc gcgcctgacc      1920
     gccgccgaga agtctggcct gacctacaag gccagcctgc gcgaagaccg cgagcgccac      1980
     ctgtggctgc ccgaggtgga actggtggcc cacggcctgt ccagctacgt caccttcaac      2040
     cgtgacttct tcgccagcaa tgactaccgc tcggtgtcgc tgctcggcga ccagctgaac      2100
     agcctgctgg aagacggcgc ctacgtgcag aagggtgagc gcaagcgccc gatcagcgcc      2160
     ttcaaggacg gcctggactg gctgatggcc gaaggtacca agcgccacag catccagcga      2220
     tacaaggggt tgggcgagat gaaccctgag cagctgtggg aaaccaccat ggatccgaac      2280
     gtccggcgca tgctcaaggt gaccatcgag gacgccatcg ccgccgacca gatcttcaac      2340
     accctgatgg gcgatgccgt ggagccgcgc cgcgacttca tcgaaagcaa cgcgctggcg      2400
     gtgtcgaacc tggacgtgtg a                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page