(data stored in ACNUC7421 zone)

EMBL: CP000438.HCPC

CP000438.HCPC        Location/Qualifiers
FT   CDS_pept        complement(288454..288972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="PA14_03240"
FT                   /product="Secreted protein Hcp"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15212"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Z8M3"
FT                   /protein_id="ABJ15212.1"
FT                   /translation="MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFN
FT                   HEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAA
FT                   GTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGS
FT                   DDWRSPVAG"
     atggcaaccc ccgcctatat gtccatcacc ggcaccaagc agggcctgat caccgccggc        60
     gccttcaccg aggactcggt cggcaacacc tatcaggaag gccacgagga ccaggtgatg       120
     gtccagggct tcaaccacga agtgatcatc ccgcgtgacc cgcagtccgg ccagccgacc       180
     ggccagcgcg tgcacaagcc tgtggtcatc accaaggtct tcgacaaggc ctcgccgctg       240
     ctgctggccg ccctgacctc cggcgagcgc ctgaccaagg tcgagatcca gtggtaccgc       300
     acctccgccg ccggcaccca ggagcactac tacaccaccg tcctggaaga cgcgatcatc       360
     gtcgacatca aggactacat gcacaactgc caggacccgg gcaacgccca cttcacccac       420
     ctggaagacg tgcacttcac ctaccgcaag atcacctgga cccacgaagt ctccggcacc       480
     tccggctccg acgactggcg ctccccggtg gcagggtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page