(data stored in ACNUC7421 zone)

EMBL: CP000438.MCDM

CP000438.MCDM        Location/Qualifiers
FT   CDS_pept        233992..234756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcdM"
FT                   /locus_tag="PA14_02640"
FT                   /product="putative malonate transporter, MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15165"
FT                   /db_xref="GOA:A0A0H2ZKD1"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD1"
FT                   /protein_id="ABJ15165.1"
FT                   /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAI
FT                   AIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
     atgttcgagt ccctgaacaa agtcatcaat ggctacggcc tgatcagcgg cttcgccatc        60
     atcggcgtga ccatggcggt gtcctactgg ttgtcggcgc gcctcacccg cgggcgcctg       120
     cacggctcgg cgatcgcgat cttcctcggc ctggtgctgt cctacgtcgg cggcgtcgcc       180
     accggcgggc agaaaggatt ggtggacgtg cccctgatgt ccggtatcgg cctgctgggc       240
     ggcgccatgc tgcgcgactt cgccatcgtc gccacggcct tcggggtgaa tgtcgaggaa       300
     ttgcgtcggg caggggtttc cggggtggtg tcgctgttcc tcggggtcgg ttcgtcgttc       360
     gtcgccgggg tcgcggtggc catggcgttc ggctacaccg atgcggtcag cctgaccacc       420
     atcggcgccg gcgcggtcac ctacatcgtc ggaccggtga ccggcgccgc cctgggggcc       480
     agctccgagg tgatggcgct gagcatcgcc gccgggctgg tgaaggcgat cctggtgatg       540
     gtcctgacgc ctttcgtcgc gccctacatc ggcctgaaca atccacgtac ggcggtgatc       600
     ttcggtggtc tcatgggcac ctccagtggc gtcgccggcg gcctcgccgc caccgacccg       660
     aagctggtgc cctacggttg cctgaccgcg gcgttctata ccgccatcgg ttgcctgctg       720
     gggccgtcgc tgctgtattt cagcgtgcgc ggcctggttg ggtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page