(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCA

CP000438.MDCA        Location/Qualifiers
FT   CDS_pept        227383..229047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PA14_02550"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15157"
FT                   /db_xref="GOA:A0A0H2ZKD9"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD9"
FT                   /protein_id="ABJ15157.1"
FT                   /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNV
FT                   YTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTAAW
FT                   LDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
     atgacgacac cgatctctcc cccgccgcag tggtcgcggc gccgccagga aaagcagcgg        60
     cgcctcgagc gcgtgcgcgg cctggccgac ggcgcggtgc tgccgcgcga acgcctggtc       120
     gccgcgctgg aggcgctgat cgcgccgggc gatcgggtgg tgctggaagg caacaaccag       180
     aagcaggcgg acttcctctc ccgttcgctg gcgcgggtcg atcccggcaa gctgcacgac       240
     ctgcacatga tcatgcccag cgtcggtcgt ccggagcatc tcgacctgtt cgaactgggc       300
     atcgcgcgca agctcgactt ctccttctcc ggcccgcaga gcctgcgcat cggccagttg       360
     ctcgaagacg gcctgctgga gatcggcgcg atccacacct acatcgagct gtacgcgcgg       420
     ctggtggtcg acctgatccc caacgtcgca ctggtcgccg gtttcgtcgc cgaccgcgaa       480
     ggcaacgtgt acaccgggcc gagcaccgaa gacaccccgg cgctggtgga gcccaccgcg       540
     ttcagcgacg gcatcgtcat cgtccaggtc aaccgtatcg tcgacgaccc gcgcgacctg       600
     ccgcgagtgg acatcccggc gtcctgggtg gacttcgtgg tcgaggccga ccagccgttc       660
     tacatcgagc cgctgttcac ccgcgacccg cgccacatca agccggtcca cgtgctgatg       720
     gcgatgatgg cgatccgcgg catctaccag cggcacaacg tgcagtcgct gaaccacggc       780
     atcggcttca acaccgcggc catcgagctg atcctgccga cctacggcga gtccctcggc       840
     ctgaagggca agatctgccg gcactggacc ctcaacccgc acccgaccct tatccccgcc       900
     atcgagagcg gctgggtcga gagcgtgcac tgcttcggca ccgagctggg catggagggc       960
     tacatcgccc agcgtcccga cgtgttcttc accggtcgcg acggctcgct gcgttccaat      1020
     cggatgttct gccaactggc cgggcagtac gcggtagacc tgttcatcgg cgccaccctc      1080
     caggtcgacg gcgacggcca ttcctccacc gtcacccgcg gacgcctggc cggcttcggc      1140
     ggcgccccga acatgggcca cgacccgcgc ggccggcgcc actcgacggc ggcctggctg      1200
     gacatgcggg gcgaacccga ggccttgctg gagcgcggca ggaagctggt ggtgcagatg      1260
     gtcgagacct tccaggacgg cggcaagccg accttcgtcg agcgtctcga cgcgctggag      1320
     gtggcgcgcc agaccggcat gccgctggcg ccggtgatga tctatggcga cgacgtcacc      1380
     catgtgctca ccgaggaagg catcgcctac ctgtacaagg cgcgctcgct ggaggaacgc      1440
     caggcgatga tcgccgcggt ggcggggatc agtccgatcg gcctgcgcca cgatccgcgc      1500
     gagacccagc ggatgcgccg cgaagggctg atcgcgctgc ccgaggacct cggcatccgc      1560
     cgcaccgacg cctcgcgcga gctgctggcg gcgaagagca tcgccgagct ggtcgagtgg      1620
     tccggcgggc tgtaccagcc gccggcgcgt ttcaggagct ggtga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page