(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCC

CP000438.MDCC        Location/Qualifiers
FT   CDS_pept        229930..230229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PA14_02570"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15159"
FT                   /db_xref="GOA:Q02UM5"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UM5"
FT                   /protein_id="ABJ15159.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVV
FT                   TSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD"
     atggaaaccc tgaccttcga atttcccgcc ggcgctccgg cgcgcggtcg cgccctggcc        60
     ggctgcgtcg gctccggcga cctggaggtg ctgctcgagc cggccgccgg aggcgcgctg       120
     agcatccagg tggtgacctc ggtaaacggc agcggcccgc gctggcaaca actcttcgcg       180
     cgggtcttcg cggcgtccac ggcgccggcc gcgtcgatcc gcatccacga tttcggcgcc       240
     actcccgggg tggtccgcct gcgcctggag caggcactgg aggaggctgg ccatgactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page