(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCD

CP000438.MDCD        Location/Qualifiers
FT   CDS_pept        230222..231085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PA14_02580"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15160"
FT                   /db_xref="GOA:A0A0H2ZKC6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC6"
FT                   /protein_id="ABJ15160.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRRLYQGL
FT                   GQGDAT"
     atgactgacg tcgcccgcct gctggcgctg cgcagcttca ccgaactggg agcgcgccaa        60
     cgcgcccgtg ccctgctcga cgcgggcagc ttccgcgagt tgctcgatcc cttcgccggc       120
     gtgcagtcac cctggctgga acgacagggc atcgtgcccc aggccgacga tggggtagtg       180
     gtcgcccgtg gcctgctcga cggccagccg gcggtgctcg ccgccatcga aggtgccttc       240
     cagggcggca gccttggcga ggtcagcgga gcgaagatcg ccggcgcgct ggagctggcc       300
     gccgaggaca accgcaacgg cgttccgacc cgggccctgc tgttgctgga aaccggtggc       360
     gtgcgcctgc aggaagccaa cctcggactg gcggcgatcg ccgagatcca ggcggccatc       420
     gtcgatctgc agcgctacca gccggtggtg gcggtgatcg ccgggccggt cggctgcttc       480
     ggcggcatgt ccatcgccgc cgggctgtgc agctacgtgc tggtgacccg cgaggcgcgc       540
     ctcggattga acggtccgca ggtgatcgaa caggaggccg gcatcgctga atacgactcg       600
     cgcgaccggc cgttcatctg gagcctcacc ggcggcgagc agcgcttcgc cagcggtctc       660
     gccgacgcct acctggccga cgacctcgat gaggtacgca cctcggtact cgcgtatttc       720
     gccaagggcc tgccggcacg gccgcgctgc cgccgcgccg aggattacct gcggcggctg       780
     ggcgacctcg ataccgccga gcaaccggat gccgccggcg tgcgccggct gtaccagggg       840
     ctgggccaag gagatgcaac atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page