(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCE

CP000438.MDCE        Location/Qualifiers
FT   CDS_pept        231082..231888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PA14_02590"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15161"
FT                   /db_xref="GOA:A0A0H2ZKL8"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL8"
FT                   /protein_id="ABJ15161.1"
FT                   /translation="MSQPFTSRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFL
FT                   AVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTA
FT                   DLVRVRTCLGEALADILGGPRDLGGRLGAANREASAQVRRLLREQW"
     atgagccaac cgttcacttc ccgtggcctg gcctggttcc aggcgctggc cggtagcctc        60
     gcgccgcgtc ccggcgatcc tgcttcgttg cgcgtcgccg atgccgagct ggacggctac       120
     ccggtgcgtt tcctggccgt cgtgcccgat cccgacaatc cgttcccgcg cgctcgccag       180
     ggcgaggtcg ggctgctcga gggctggggc ctggccgccg ccgtcgacga ggcgctggag       240
     gccgaccgcg aggcgccgcg caagcgcgcg ctgctggcca tcgtcgacgt gccgagccag       300
     gcctacggcc gccgcgagga ggccctgggt atccaccagg cgctggccgg ggcggtggat       360
     gcctacgccc gcgcccgact cgccgggcat ccgctgatcg gcctgctggt gggcaaggcg       420
     atgtccggtg cgttcctcgc ccacggctac caggccaacc gcctgatcgc cttgcacgat       480
     ccgggggtga tggtccacgc catgggcaag gccgccgccg cgcggatcac cctgcgcagc       540
     gtcgaggaac tggaggcgtt ggcggcgaag gtgccgccga tggcctacga catcgacagc       600
     tacgcgtcgc tcggcctgct ctggaggacc cttccggtgg agaccgtcga ggtgccgtcg       660
     acggcggacc tggtgcgggt ccgcacctgc ctgggcgagg ccctggccga tatcctcggc       720
     ggcccgcgcg acctcggcgg ccgcctcggc gcggccaacc gcgaggcgtc ggcgcaggtg       780
     cgccggctgc tgcgcgagca gtggtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page