(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCH

CP000438.MDCH        Location/Qualifiers
FT   CDS_pept        232593..233525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="PA14_02620"
FT                   /product="putative epsilon subunit of malonate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15163"
FT                   /db_xref="GOA:A0A0H2ZJE9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJE9"
FT                   /protein_id="ABJ15163.1"
FT                   /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAEL
FT                   ESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDA
FT                   LRLVALRGELMQAAWPEGYGMSAILGLDQAQLDALILMVRREHPPLYLANVNAERQLVV
FT                   AGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGVRLRRPRVPY
FT                   LSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGSRADTLDALLREEEKRTR"
     atgagcgtgc tgttcgccta tcccggccag ggcgcccaac gtcccggcat gctcgcggcc        60
     ttgcccgacg aaccgccggt gcgcgcctgc ctggagcagg cggcggactg tctcggccag       120
     gcgccggccg aactggagag cgccgaggcc ttgcgcggca cccgcgcggt gcagttgtgc       180
     ctgctgatcg ccggggtcgc cgccagccgc ctgctggaga cgcgcgggca tcggccgggg       240
     ctggtcgccg ggctgtccat cggcgcctat ccggcggcgg tggtggccgg cgcgctggac       300
     ttcgacgacg cgctgcgtct ggtggcgctg cgcggcgaac tgatgcaggc cgcctggccc       360
     gagggctacg ggatgagcgc catcctcggt ctcgaccagg cgcaactgga tgcgctgatc       420
     ctgatggtgc ggcgcgagca cccgccgctc tacctggcca acgtcaacgc cgagcggcaa       480
     ctggtggtgg ccggcagcga agcggcgctg gccgccctcg ccgaacgcgc gcgtgccgcc       540
     ggcgccagcg cggcgaagcg cctggcggtg agcgtaccgt cgcactgtgc gctgctcgac       600
     gaaccggccg cgcgcctggc cgaagcgttc gccggtgtcc gcctgcgtcg gccgcgcgtg       660
     ccctacctga gcagcagccg ggcgcgcctg gtcgccgaac cggccgcgct ggccgacgat       720
     ctcgccggca acatggcgcg ccgcgtcgag tggctggcga cattgcgcag cgcctacgag       780
     cgcggtgccc gcctgcatct cgagctgccg ccgggacggg tcctcagcgg tctggcgcgg       840
     cctctgttcg gctgcgccac gccggccttc gaaggctccc gggcggatac cctggacgcg       900
     ctgttgcgcg aggaggaaaa gagaacccga taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page