(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCL

CP000438.MDCL        Location/Qualifiers
FT   CDS_pept        233582..233986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcL"
FT                   /locus_tag="PA14_02630"
FT                   /product="putative malonate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15164"
FT                   /db_xref="GOA:A0A0H2ZKE5"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE5"
FT                   /protein_id="ABJ15164.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLIF
FT                   VGGYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRFGRKKAEGAPPLKPRTSVQG"
     atgattatct acggtgtcgc actgctgtct ctgtgtaccc tcgccgggct gttcatcggc        60
     gagatccttg gcgtgctgct cggcgtgccg gccaacgtcg gtggcgtcgg catcgccatg       120
     ctgctgctga tcttcgtcgg cggctacctg ggcaagcgcg gcctgctctc ggcgaagacc       180
     gagcagggcg tggagttctg gagcgcggtc tacattccca tcgtggtcgc catggccgcc       240
     cagcagaacg tcctcggcgc gctgagcggc gggccggccg ctatcctcgc cggcatcgcc       300
     gcggtcgccg tggccttcgc cctggtcccg ctgctcgacc gcttcggccg gaagaaagcc       360
     gaaggcgccc cgccgttgaa accgcgcacc agcgtgcagg ggtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page