(data stored in ACNUC7421 zone)

EMBL: CP000438.METW

CP000438.METW        Location/Qualifiers
FT   CDS_pept        complement(444738..445358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="PA14_05070"
FT                   /product="putative methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15355"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL16"
FT                   /protein_id="ABJ15355.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRNLAV"
     atgcgcgccg atcttgaaat catccaggaa tggattcccg ccggcagccg cgtcctcgac        60
     ctcggctgcg gcgacggcga actcctggcc tggctgcgcg accacaagca ggtcagcggc       120
     tacggcctgg agatcgaccc cgacaacatc gcccgttgca tcgaaaacgg ggtgaacgtg       180
     atcgagcagg acctcgacaa gggcctgggc aacttcgcca gcgacagctt cgacgtggtg       240
     gtgatgaccc aggcgctaca ggccgtgcac tatccggaca agatcctcga agagatgctg       300
     cgggtcggca agacctgcat catcaccttc cccaacttcg gccactggcg ctgccgctgg       360
     tacctggcgc gcaacggccg gatgccggtc tccgagttcc tgccgtatac ctggtacaac       420
     acgccgaaca tccatttctg caccttccag gacttcgagc gcctgtgccg ccagttgcgc       480
     atgcgcgtgc tcgaccgcct ggccgtagac cgtgaccacc ggcatggctg ggccagccgg       540
     ctgtggccta atctattggg tgagattgga atctaccggg tcaccggacc cggagtgcag       600
     acccgcaacc tcgccgtcta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page