(data stored in ACNUC7421 zone)

EMBL: CP000438.MEXA

CP000438.MEXA        Location/Qualifiers
FT   CDS_pept        486775..487926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /gene_synonym="arpA"
FT                   /locus_tag="PA14_05530"
FT                   /product="RND multidrug efflux membrane fusion protein MexA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15392"
FT                   /db_xref="GOA:A0A0H2ZKX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX6"
FT                   /protein_id="ABJ15392.1"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
     atgcaacgaa cgccagccat gcgtgtactg gttccggccc tgctggtcgc gatttcggcc        60
     ctttccgggt gcggaaaaag cgaggcgccg ccgccggcgc aaacgccgga ggtcggaatc       120
     gtgaccctgg aagcgcagac ggtgaccctg aataccgagc tgccgggccg gaccaatgcg       180
     ttccgcatcg ccgaggtgcg tccccaggtg aacggcatca tcctcaagcg cctgttcaag       240
     gaaggcagcg acgtcaaggc cgggcagcag ctctaccaga tcgaccccgc cacctacgag       300
     gccgactacc agagcgccca ggccaacctg gcctcgaccc aggagcaggc ccagcgctac       360
     aagctgctgg tcgccgacca ggccgtgagc aagcagcagt acgccgacgc caatgccgcc       420
     tacctgcagt ccaaggcggc ggtggaacag gcgcggatca acctgcgcta caccaaggtg       480
     ctgtcgccga tctccggccg catcggccgt tccgcggtga ccgaaggcgc cctggtgacc       540
     aacggccagg ccaacgcgat ggccaccgtg caacagctcg acccgatcta cgtcgacgtc       600
     acccagccgt ccaccgccct gctgcgcctg cgccgcgaac tggccagcgg ccagttggag       660
     cgcgccggcg acaacgctgc gaaggtctcc ctgaagctgg aggacggtag ccaatacccg       720
     ctggaaggcc gcctcgaatt ctccgaggtt tccgtcgacg aaggcaccgg ctcggtcacc       780
     atccgcgccg tgttccccaa cccgaacaac gagctgctgc ccggcatgtt cgttcacgcg       840
     cagttgcagg aaggcgtcaa gcagaaggcc atcctcgctc cgcagcaagg cgtgacccgc       900
     gacctcaagg gccaggctac cgcgctggtg gtgaacgcgc agaacaaggt cgagctgcgg       960
     gtgatcaagg ccgaccgggt gatcggcgac aagtggctgg tcaccgaagg cctgaacgcc      1020
     ggcgacaaga tcattaccga aggcctgcag ttcgtgcagc cgggtgtcga ggtgaagacc      1080
     gtgccggcga agaatgtcgc gtccgcgcag aaggccgacg ccgctccggc gaaaaccgac      1140
     agcaagggct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page