(data stored in ACNUC7421 zone)

EMBL: CP000438.MICA

CP000438.MICA        Location/Qualifiers
FT   CDS_pept        439406..440077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="micA"
FT                   /gene_synonym="yggH"
FT                   /locus_tag="PA14_05000"
FT                   /product="DNA mismatch repair protein MicA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15348"
FT                   /db_xref="GOA:Q02U31"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U31"
FT                   /protein_id="ABJ15348.1"
FT                   /translation="MRTVKSFVMRAGRMTEGQQRGLDLGWPKFGLELSDEVQDFDAIFG
FT                   RQAPRTFEIGFGMGHSTLEMAAAAPDIDFIGVEVHKPGVGALLNGLLTQGLGNVRVYSC
FT                   DALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVGGVLHMAT
FT                   DWEPYAEHMLDVMSAAPGYRNQAEDGRFVARPQERPVTKFERRGERLGHGVWDLKFERI
FT                   D"
     atgcgcaccg tgaagagctt cgtgatgcgc gccgggcgca tgaccgaagg ccagcagcgt        60
     ggcctcgacc tgggctggcc gaagttcggc ctggaactga gcgatgaggt tcaggacttc       120
     gacgcgatct tcggtcgcca ggcgccgcgg actttcgaga tcggtttcgg catgggccat       180
     tccaccctgg aaatggccgc cgccgcgcct gacatcgact tcatcggcgt cgaggtgcac       240
     aagccgggcg tcggcgcgct gctcaacggc ctgctgaccc agggcctggg caacgtgcgg       300
     gtgtatagct gcgacgcgct ggaagtgctg cgccactgcg tggccgacgc cagcctcgat       360
     cggctgctgc tgttcttccc cgatccctgg cacaagaagc gccaccacaa gcggcggatc       420
     gtccagccgg aattcgccga actggtgcgg cgcaagctga aggtcggcgg cgtgctgcac       480
     atggccaccg actgggagcc ctatgccgag cacatgctgg acgtcatgag cgcggcgccg       540
     ggctaccgca accaggccga agacggccgc ttcgtagcgc gcccgcaaga gcgtccggtg       600
     accaagttcg aacggcgcgg ggagcgcctg ggacatggcg tctgggacct caagttcgag       660
     cgcatcgact ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page