(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRD

CP000438.NIRD        Location/Qualifiers
FT   CDS_pept        complement(586014..586466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="PA14_06710"
FT                   /product="heme d1 biosynthesis protein NirD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15477"
FT                   /db_xref="GOA:A0A0H2ZL47"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL47"
FT                   /protein_id="ABJ15477.1"
FT                   /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRLE
FT                   ADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHRYNLWF
FT                   VLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
     atggacgacc tctcccgccg cctcctcgcc cgctaccaga aaggcctgcc gatctgcgcg        60
     gaaccctatc ggcggatggc cgagaccctg ggttgcagcg aagccgaggt gctcgaacgg       120
     ctgcgtcgcc tggaagccga cggcgcgttg tcgcgggtcg gcccggtgct ccgccaccaa       180
     cgcgccgggg ccagcaccct ggctgccctg gcggtgcccg aggagcgtct gcaacgggtc       240
     gccgagcgca tcagccagta cgccgaggtc aaccacaact accagcgcga acaccgctac       300
     aacctgtggt tcgtgctcac cgccggcgac cgcgcgcaac tcgaccgggt actggcggag       360
     atcgccgccg acaccggcct gcaacccctc gacctgccga tgcaggaagc ctactgcatc       420
     gacctcgcgt ttcccctgga ggccagccga tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page