(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRF

CP000438.NIRF        Location/Qualifiers
FT   CDS_pept        complement(586475..587653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PA14_06720"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15478"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ6"
FT                   /protein_id="ABJ15478.1"
FT                   /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTKLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPHLTRFRDIGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQLQVWDPYRLKRIGSLPARSPSGIFFSHRAQHIGL"
     atgaacctgc gtcccctcgc gccgcttttc ctcgccctgc tcgccggctg tagccagcag        60
     ccgcccttgc gcggcagcgg cgacctcggc gtgctgatcg aacgcgccga cggcagcgtg       120
     cagatcctcg acggcacggc gaagacctcg ctggcgcggg tcgaaggcct cggcgacctg       180
     tcccacgcct ccctggtgtt ctcccgcgac cagcgctacg cctacgtatt cggtcgcgac       240
     ggcggcctga ccaagctcga cctgctggcc cagcgcatcg acaagcgcct gatccagggc       300
     ggcaacagca tcggcggagc gatcagccag gacggtcggc tggtcgcggt atccaactac       360
     gagccgggcg gggtcaaggt gttcgacagc cgcaccctgg agctggtcgc cgagattccc       420
     gccacccgcc tccccggcca ggacaggaac tcccgggtgg tcggcctggt cgacgcgccc       480
     gggcagcgct tcgtgttcag cctgttcgac agcggcgaga tctggatcgc cgacttcagc       540
     cagggcgaca cgccgcacct gacccgcttc cgcgatatcg gcaagcaacc ctacgacgcc       600
     ctcatcagtc ccgacgggcg ctactacatg gccgggctgt tcggcgagga cggcatggcc       660
     cagctcgacc tctggcaccc ggagcgcggc gtcaggcgcg tactcggcga ctacggccgc       720
     ggccaacgca agctgccggt gtacaagatg ccgcacctgg agggctggac catcgccagc       780
     gaccaggcct tcgtcccggc ggtcggccat caccaggtgc tggtgctcga cgcgcgcgac       840
     tggaagcaga ccgacgccat cgacgtcgcc ggccagccgg tgttcgtcat gactcgaccg       900
     gacgaccggc agatctgggt caacttcgcc tacccggaca acgacaaggt gcaggtcatc       960
     gacagcgaga cccacgaagt gatcgaaacc ctgcgccctg gccccggcgt actgcacatg      1020
     gaattcagcg ggcgcggcga ccaggtctgg atctcggtgc gcgacgccga ccagttgcag      1080
     gtctgggacc cgtaccgcct gaagcgcatc ggcagccttc cggcccgcag cccgagcggc      1140
     atcttcttca gccaccgcgc ccagcacatc ggactctag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page