(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRG

CP000438.NIRG        Location/Qualifiers
FT   CDS_pept        complement(585057..585500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirG"
FT                   /locus_tag="PA14_06690"
FT                   /product="heme d1 biosynthesis protein NirG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15475"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE0"
FT                   /protein_id="ABJ15475.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAAELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEEIAALLAGWPQVAHNYRREHALNMW
FT                   LVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
     atggatgagt tcgaccggcg cctgctgaac cgcctgcaac acggcctgcc gctggagccg        60
     catccctacg cgctgctcgc cgccgagctg gattgccgcg aggaagacat cctgcgccgc       120
     ctcgacgacc tgctcgacga cggcaccctg acccgcttcg gtccgctgtt cgatatcgag       180
     cccctcggcg gtgccttcac cctggccgcc atgagcgtgc cggaggcgcg tttcgaagag       240
     atcgccgcgc tgctcgccgg ctggccgcag gtcgcccaca actaccgtcg cgagcacgcc       300
     ctgaacatgt ggctggtggt cgcctgcgac agcccggcgg aggtcgccga gacccttgca       360
     cggctggagc gcgagagcgg gctggcggta ctcgacctgc ccaaggaggc gacctaccat       420
     gtcggcctgc atttccccct ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page