(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRH

CP000438.NIRH        Location/Qualifiers
FT   CDS_pept        complement(584567..585082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirH"
FT                   /locus_tag="PA14_06680"
FT                   /product="heme d1 biosynthesis protein NirH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15474"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR1"
FT                   /protein_id="ABJ15474.1"
FT                   /translation="MSACISPSDALLARRLIELTQAGLPLVADPWAWIAAQLRLSEAET
FT                   LALLKRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRHLPQWRYNLFAMVHGRSEAEIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
     atgtcggcct gcatttcccc ctctgacgcc ctgctcgccc gccgcctgat cgaactgacc        60
     caggccggcc tgccgctggt cgccgaccct tgggcgtgga tcgccgcgca actgcggctg       120
     agcgaggcgg agaccctggc gctgctgaag cgcctgcgcg acgccggggt gatccggcgc       180
     atcgctgcgg tgcccaacca ctatcgcctt ggctaccggc acaacggcat gaccgtctgg       240
     gacgtcgccg acgaacgcat cgaacgcctc ggccggctgg tcggcgggct gtccttcgtc       300
     agccattgct accggcgccc gcgccatctg ccgcagtggc gctacaacct gttcgccatg       360
     gtccacggcc gcagcgaagc ggagatcgaa ggctaccgcc agcagatccg cctgctgctc       420
     ggcgaggact gtcgcgccga cgagatgctg gtgagcagcc gcatcctgaa gaagaccggc       480
     ctgcgcctgg cgcagaagga ggaacgtcca tgctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page