(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRL

CP000438.NIRL        Location/Qualifiers
FT   CDS_pept        complement(585493..586017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PA14_06700"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15476"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD1"
FT                   /protein_id="ABJ15476.1"
FT                   /translation="MNPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDVVGRALAHETIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERGEVERQIEALLERHALRQTPHRWLFSLRAYKQCGGRYT
FT                   APPADLERRHG"
     atgaaccccg tcgaacccct cgccgcgccg cagcggcaac acctgcgcta cctgctggaa        60
     cagggcctgc cgctggccag ccggccctac cgggtgctcg ccgaacgcat cggcgccggc       120
     gaagacgaag tgctggaaca ggtccgccgc tgggacgaag acggcctgtt ccgccgcttc       180
     ggagtgatcc tccaccaccg cgccctgggc tataccgcca acgccatgct ggtgctggac       240
     gtcgccgacg cggaggtcga cgtcgtcggc cgcgccctcg cccacgaaac gatcgtctcg       300
     ctctgttacc gccgcccgcg tcgcctgccg atgtggccat acaacctgtt ttgcatgatc       360
     cacggccgcg agcgcggcga agtggaacgc cagatcgagg ccctgctgga gcgccacgcc       420
     ctgcgccaga caccgcaccg ctggctgttc agcctgcgcg cctacaagca gtgcggcggc       480
     cgctacaccg cgccgccggc cgacctggag cgccgccatg gatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page