(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRO

CP000438.NIRO        Location/Qualifiers
FT   CDS_pept        591110..591637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirO"
FT                   /locus_tag="PA14_06790"
FT                   /product="cytochrome c oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15483"
FT                   /db_xref="GOA:A0A0H2ZLK1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK1"
FT                   /protein_id="ABJ15483.1"
FT                   /translation="MWFFILAELSVFSLLLLAFAGAQAWQPELFRAGREQLDSRWGLLL
FT                   TVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLKLHEYGRLADLGLDIE
FT                   HDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRCYTPQACSGLESGVLYWHMVDLV
FT                   WVLLFPLVYVLQ"
     atgtggttct tcatcctcgc cgaactcagc gtgttcagcc tgctgctgct ggcgttcgcc        60
     ggcgcccagg cctggcagcc ggagctgttc cgtgccggcc gggagcaact ggatagccgc       120
     tggggcctgt tgctgaccgt ggccctgctc agctccggct ggctcgccgc gctggcggtg       180
     catgcggtgc gccgcggacg gccgcgccag gcgagcggct ggttgctggc ggcgctgctg       240
     ctggcgctgg tctacgtcgg cctgaagctg cacgagtacg ggcggctcgc cgatctcggc       300
     ctggacatcg agcacgacac tttcttcacc ctctactggt gcctgaccgg cttccatttc       360
     ctccacgtcc tgctcggcct gctgatcctc ggctggctgg cgcaggcctg ctggcgccgg       420
     tgttatacgc cgcaggcttg ctcgggactg gagtcgggag tgctctactg gcacatggtc       480
     gacctggtct gggtgctgct gttcccgctg gtctacgtcc tgcaatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page