(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRQ

CP000438.NIRQ        Location/Qualifiers
FT   CDS_pept        590293..591075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PA14_06770"
FT                   /product="regulatory protein NirQ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15482"
FT                   /db_xref="GOA:A0A0H2ZL51"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL51"
FT                   /protein_id="ABJ15482.1"
FT                   /translation="MRDATPFYEATGHEIEVFERAWRHGLPVLLKGPTGCGKTRFVQYM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQHEARILVGESGCAEALAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVA"
     atgcgggacg cgacaccctt ctacgaggcc accggccatg agatcgaagt cttcgagcgc        60
     gcctggcggc acggcctgcc ggtattgctc aagggcccca ccggttgcgg caagacccgc       120
     ttcgtccagt acatggcgcg gcgcctggaa ctgccgctgt acagcgtcgc ctgccacgac       180
     gacctgggcg ccgccgacct gctcggccgc catctgatcg gcgccgacgg cacctggtgg       240
     caggacggcc cgctgacccg cgcggtgcgc gaaggcggta tctgctacct ggacgaagtg       300
     gtggaggcgc gccaggacac cacggtcgcc atccacccgc tggccgacga ccgccgcgag       360
     ctgtacctgg agcgcaccgg cgagacgttg caggcgccgc cttcgttcat gctggtggtg       420
     tcctacaacc ccggctacca gaacctgctc aagggcctga agcccagcac ccggcagcgt       480
     ttcgtcgcgt tgcgcttcga ctacccggcg gcgcagcacg aggcacgcat cctggtcggc       540
     gagagcggtt gtgccgaggc cctggcgcag cgcctggtgc agttgggcca ggcgctgcgg       600
     cggctggagc agcacgacct ggaggaagtc gcctcgaccc gcctgctgat cttcgccgcg       660
     cgcctcatcg gcgacggcat ggacccgcgc gaggcgtgcc gggtggcgct ggccgaaccg       720
     ctctcggacg acccggcgac ggtggcggcg ctgatggaca tcgtcgatct ccatgtcgcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page