(data stored in ACNUC7421 zone)

EMBL: CP000438.NORB

CP000438.NORB        Location/Qualifiers
FT   CDS_pept        592432..593829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PA14_06830"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15486"
FT                   /db_xref="GOA:A0A0H2ZLE2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE2"
FT                   /protein_id="ABJ15486.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAA
FT                   GVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVL
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKVTGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHG
FT                   TQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVF
FT                   ITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSF
FT                   RRGKAAA"
     atgatgtcgc ccaatggctc cctgaaattc gcctcgcagg cggtcgccaa accctacttc        60
     gtgttcgccc tgatcctctt cgtcgggcag atcctgttcg gcctgatcat gggcctgcag       120
     tacgtggtcg gcgacttcct gttcccggcg atccccttca acgtcgcgcg catggtgcac       180
     accaacctgc tgatcgtctg gctgctgttc ggcttcatgg gcgctgccta ctacctggtg       240
     ccggaggaga gcgactgcga gctgtacagc ccgaagctgg cctggatcct gttctgggta       300
     ttcgccgccg ccggcgtgct gaccatcctc ggctacctgc tggtgcccta cgccggcctg       360
     gccaggctca ccggcaacga actgtggccg accatgggcc gcgagttcct cgaacagccg       420
     accatcagca aggcgggcat cgtgatcgtc gccctgggct tcctgttcaa cgtcggcatg       480
     accgtgctgc gcgggcgcaa gaccgccatc agcatggtcc tgatgaccgg cctgatcggc       540
     ctcgccctgc tgttcctgtt ctccttctac aacccggaaa acctcacccg cgacaagttc       600
     tactggtggt gggtggtgca cctgtgggtg gaaggcgtgt gggaactgat catgggtgcg       660
     atcctcgcct tcgtgctggt gaaggtcacc ggggtcgacc gcgaggtgat cgagaagtgg       720
     ctctacgtga tcatcgccat ggcgctgatc agcggcatca tcggcaccgg ccaccactac       780
     ttctggatcg gcgtgcccgg ctactggctg tggctcggct cggtattctc ggcgctggag       840
     ccgctgccgt tcttcgccat ggtgctgttc gccttcaaca ccatcaaccg ccgccgccgc       900
     gactatccga accgcgcggt cgcgctgtgg gccatgggca ccacagtgat ggccttcctc       960
     ggcgcgggag tgtggggctt catgcatacc ctggcgccgg tcaactacta cacccacggc      1020
     acccagctca ccgccgccca cggccacatg gccttctatg gcgcctacgc gatgatcgtg      1080
     atgaccatca tctcctacgc catgccgcgc ctgcgcggga tcggcgaggc gatggacaac      1140
     cgctcgcagg tcctggagat gtggggcttc tggctgatga ccgtggcgat ggtgttcatc      1200
     accctgttcc tctccgcggc cggggtgctg caggtctggc tgcaacggat gccggcggac      1260
     ggcgcggcga tgaccttcat ggccacccag gaccagctgg cgatcttcta ctggctgcgc      1320
     gaaggcgccg gggtggtgtt cctcatcggc ctggtcgcct acctgctgag cttccggcgc      1380
     ggcaaggcgg ccgcctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page