(data stored in ACNUC7421 zone)

EMBL: CP000438.NORC

CP000438.NORC        Location/Qualifiers
FT   CDS_pept        591992..592432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PA14_06810"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15485"
FT                   /db_xref="GOA:A0A0H2ZKE8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE8"
FT                   /protein_id="ABJ15485.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
     atgtccgaga cctttaccaa aggcatggcc aggaacatct atttcggcgg gagtgtgttc        60
     ttcatcctgc tgttcctggc cctgacctac cacaccgaga agaccctgcc cgagcgcacc       120
     aacgaggccg cgatgagcgc cgcggtggtg cgcggcaagc tggtctggga gcagaacaac       180
     tgcgtcggct gccacaccct gctcggcgag ggcgcctact tcgcgccgga gctgggcaac       240
     gtggtcggac gccgtggcgg cgaggagggc ttcaacacct tcctccaggc ctggatgaag       300
     atccagccgc tgaacgtgcc gggccgccgc gccatgccgc agttccatct cagcgagggc       360
     caggtcgacg acctggccga gttcctcaag tggagctcga agatcgatac caaccaatgg       420
     ccgccgaaca aggagggttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page