(data stored in ACNUC7421 zone)

EMBL: CP000438.NORD

CP000438.NORD        Location/Qualifiers
FT   CDS_pept        593831..595669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norD"
FT                   /locus_tag="PA14_06840"
FT                   /product="putative dinitrification protein NorD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15487"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL56"
FT                   /protein_id="ABJ15487.1"
FT                   /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGMLF
FT                   RALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQAE
FT                   LNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRPSLD
FT                   DCPAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDGEEAA
FT                   AGAGKRQVARSGARKRAERVEERESERNLLLFRLESLLSWSEHLALDRCSDDEDDPDGA
FT                   RVAEDLDYLSLSRQRTQKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQRLLSDHV
FT                   LLQPMRPRGATSASLPAHLEKTALHLRRQFACLRDGRQRLRQQPQGDEIDLDAWLDFQV
FT                   ERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVDSLLLFGEA
FT                   LQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYTRMGAAIRRA
FT                   SQELGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGLVPFCITIDKE
FT                   AADYLPYLFGADGFALVERAGQLPERLLQLYRRLRR"
     atggccttcg ccgtcgagct ggaggaatgg gtcggcgccc actggcaccg cttcatcacc        60
     cgccatgcca gcggcgagtt cgaggcggcg cgggtgaccc tggagagcat gcggcgtccg       120
     ctcggcatgc tcttccgggc gctcggcggc gcaccggggg tagccctcga ggcgaccccg       180
     gcgcgccgcc tgctgctacg ccgcacctgg ttgcagcggg tcgccgggac ctgcgagcag       240
     gccccggtgt cctggttcaa cggcgacagc ctgcgcctgc cggaatccct cgcggtctat       300
     ccgcaggccg agctgaaccg tgaactgtat cgctggctgg cgctactggc ggccagcgcc       360
     gggccgctgc ggcactgggc ccaggacaac cagcgctggg cgcggcagtt gctcgatgcc       420
     tatccggcgc tgcgcccgcg ctacgcccgg ctggtcgccg cgcatctgcg ccagcgcccg       480
     tcgctggacg attgcccggc ggcagacgcc gaactggaaa tcgccctgcg ccgcgcgctt       540
     gccgagccgg gcagcgtcga gcgcttcccg cgagtcgagc gggcgccctg gccggtgccg       600
     ctgtggctgt atcccggcga gcgctggacg ccttccgcca gcgcggagga cggcgaggaa       660
     gcggccgccg gcgccggcaa gcgccaggtc gcccgcagcg gagcgcgcaa gcgcgccgag       720
     cgcgtcgagg agcgcgagag cgagcgcaac ctgctgctgt tccgcctgga aagcctgctc       780
     agttggtcgg agcacctggc cctggaccgc tgtagcgacg acgaggacga cccggacggc       840
     gcgcgcgtcg ccgaagacct cgactacctg tcgctgtcgc gccagcgcac gcagaagggc       900
     ggcggcctgc gcctggatct cgacctgccg gccgccgact acgatgacct gccgctcggc       960
     cccgggctga agctgcccga gtgggactat cggcagcagc gcctgctgag cgaccacgtg      1020
     ctgctgcaac cgatgcggcc gcgcggcgcg accagcgcca gcctgccggc gcacctggag      1080
     aagaccgcgc tgcatctgcg ccgccagttc gcctgcctgc gcgacggtcg ccaacgcctg      1140
     cgccagcagc cgcaaggcga cgagatcgac ctcgatgcct ggctcgactt ccaggtcgag      1200
     cggcggcgcg gcggttccac ccagccaggc ctgttcctcg aacagcggcc gcgccggcgc      1260
     gacctcgcct gcctgttgct ggcggacctg tcgatgtcca ccgaagccta cctcgacgac      1320
     cagcggcgag tgatcgacag catcgtcgac agcctgctgc tgttcggcga ggcattgcag      1380
     gcactgggcg accccttcgc gctgtacggg ttttcctcgg tgcgccggca gcaggtgcgc      1440
     tggcaggtgc tgaaggactt cgacgaaggc tacggcggcg aggtccgcgg tcgcgtgctg      1500
     gcgctctcgc cgggctacta cacgcggatg ggcgcggcga tccgccgggc cagccaggag      1560
     ctcggcgggc agccgcagaa gcgtcgcctg ctgttgctgt tgagcgacgg caagcccaac      1620
     gacctggacc gctacgaggg ccgctacggc atcgaggaca cccgccaggc ggtgatcgag      1680
     gcgcgcagcc agggactggt gccgttctgc atcaccatcg acaaggaggc ggcggactac      1740
     ctgccctacc tgttcggcgc cgacggcttc gcgctggtcg agcgcgccgg gcagttgccc      1800
     gagcgcctgc tccagctcta tcggcgcctg cgccgctga                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page