(data stored in ACNUC7421 zone)

EMBL: CP000438.OPRM

CP000438.OPRM        Location/Qualifiers
FT   CDS_pept        491084..492541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PA14_05550"
FT                   /product="major intrinsic multiple antibiotic resistance
FT                   efflux outer membrane protein OprM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15394"
FT                   /db_xref="GOA:A0A0H2ZKJ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ8"
FT                   /protein_id="ABJ15394.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
     atgaaacggt ccttcctttc cctggcggta gccgctgtcg ttctgtccgg ctgctcgctg        60
     atccccgact accagcgccc cgaggcgccg gtagccgcgg cctacccgca agggcaggcc       120
     tacgggcaga acaccggcgc ggcggccgtt ccggccgccg acatcggctg gcgcgagttc       180
     ttccgcgacc cgcagttgca gcaactgatc ggcgtggcgc tggaaaacaa ccgcgacctg       240
     cgggtcgccg cgttgaacgt cgaggccttc cgggcgcagt accgcatcca gcgggccgac       300
     ctgttcccgc ggatcggcgt ggacggtagc ggcacccgcc agcgtttgcc gggcgacctg       360
     tcgaccaccg gcagtccggc gatttccagc cagtacgggg tgaccctggg cactaccgcc       420
     tgggaactcg atctcttcgg ccgcctgcgc agcctgcgcg accaggccct ggagcagtac       480
     ctggcgaccg aacaggcgca gcgcagcgcg cagaccaccc tggtggccag cgtggcgacc       540
     gcctacctga cgctgaaggc cgaccaggcg cagttgcaac tgaccaagga caccctgggc       600
     acctaccaga agagtttcga cctgacccag cgcagctacg acgtcggcgt cgcctccgcg       660
     ctcgacctgc gccaggcgca gaccgccgtg gaaggcgccc gcgcgaccct ggcgcagtac       720
     acccgcctgg tagcccagga ccagaatgca ctggtcctgc tgctgggttc cgggatcccg       780
     gcgaacctgc cgcaaggcct gggcctggac cagaccctgc tgaccgaagt gccggcgggc       840
     ctgccgtcgg acctgctgca acggcgcccg gacatcctcg aggccgagca ccagctcatg       900
     gccgccaacg ccagcatcgg cgccgcgcgc gcggcgttct tcccgagcat cagcctgacc       960
     gccaacgccg gcaccatgag ccgccagctg tccggcctgt tcgacgccgg ttcgggctcc      1020
     tggttgttcc agccgtcgat caacctgccg atcttcaccg ccggcagcct gcgcgccagc      1080
     ctggactacg cgaagatcca gaaggacatc aacgtcgcgc agtacgagaa ggcgatccag      1140
     accgccttcc aggaagtcgc cgacggtctg gccgcgcgcg gtaccttcac cgagcagttg      1200
     caggcacagc gcgatctggt caaggccagc gacgagtact accagctcgc cgacaagcgc      1260
     taccgcacgg gggtggacaa ctacctgacc ctgctcgacg cgcaacgctc gctgttcacc      1320
     gcgcagcagc aactgatcac cgaccgcctc aaccagctga ccagcgaggt caacctgtac      1380
     aaggccctcg gcggcggctg gaaccagcag accgtgaccc agcagcagac cgcgaagaag      1440
     gaagatccgc aggcctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page